CAZyme Information: MGYG000003486_01157

Basic Information

• Species: CAG-95 sp000436115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000436115
• CAZyme ID: MGYG000003486_01157
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659	MGYG000003486_34|CGC2	75661.66	6.9278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003486	2822689	MAG	Fiji	Oceania

• Gene Location: Start: 101754; End: 103733 Strand: +

Full Sequence      

MNEEKNGRSVDYQEEYEKEHLRCADLAGRVADLEAKCEDLDFKLKRIKNNPIWKASAPAR
KAMHFCIRQYGRVKNCGNLRGILAKIRYKQREKEAMKRYGTDSFPSPEEAEKQRNTQFPR
MVKISILVPLFNTPENFLREMIESVTAQTYENWELCLADGSDQEHAYVAEVVKEYEKQDG
RGRIVYKKLSKNGGISENTNECLKLATGEYIGLFDHDDLLHPAVLFEYVKAINEKNADYL
YCDETTFKSGDLNKMLTMHFKPDFAIDNLRANNYICHFSVFDRKLLDGTELFRSRFDGSQ
DHDMILRLTDRAQNIVHIPKLLYYWRSHPGSTAAGLSAKPYTVAAAKGAVADHLRRHGFE
HFQITSTRAFDTIFKIRYQILGSPLISIIIANKDHVEDLSRCVSSILEKSTYENYEIIIV
ENNSQDAKTFAYYEELQTNEKIRVITYKGVFNYSAVNNLGVSKARGEYVLLLNNDTQVIT
VNWMEELLMYAQREDVGAVGAKLYYGDKTIQHAGVVLGLGAHRTAGHSHYGQHRDNLGYM
GRLCYAQNVSAVTGACLLVKKELFLEVGGLDEGFAVSLNDVDFCIKLRQKGYLNVFTPFA
ELYHFESRSRGLDDQGEKAERYNRESEKFREKWKEVLEAGDPYYNPNFSLDRSDFSLKI

Enzyme Prediction     

No EC number prediction in MGYG000003486_01157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	125	286	4.1e-24	0.9705882352941176
GT2	387	566	1.6e-19	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.91e-85	123	326	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.30e-43	388	606	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.83e-30	384	632	3	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.34e-21	125	286	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	6.49e-20	125	332	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33299.1	0.0	10	659	4	673
AOZ95572.1	0.0	10	659	4	675
QNM02106.1	0.0	10	658	4	678
QUO22278.1	3.34e-286	38	659	12	630
CAB1243278.1	1.13e-243	4	658	370	1033

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.57e-134	124	657	368	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	4.22e-79	105	658	302	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	1.15e-14	124	475	15	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q58457	3.11e-12	124	307	10	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	8.53e-12	124	331	5	220	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003486_01157.