CAZyme Information: MGYG000003486_01348

Basic Information

• Species: CAG-95 sp000436115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000436115
• CAZyme ID: MGYG000003486_01348
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		28338.59	8.7889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003486	2822689	MAG	Fiji	Oceania

• Gene Location: Start: 61578; End: 62312 Strand: -

Full Sequence      

MIPKIIHYCWFGYNKKPGLIKKCIASWRKYMPDWEIREWNESNYDVTKNTFVRNAYQQKK
WAFVVDYARFDILNQYGGIFLDTDVELLRPMPQEILAHEAFTGFENPGRVNPGLVYGTIS
RQEVLQDILSAYEKRSFGEQVDGRIENIVDVVSGVLSMGGLKCNGEFQMIRGVAIYPQDY
FCCFNFETQGFETTENTVSIHHYFASWTPLGRRIHFKLVKAAAAFLGKERYLALKRKIKG
ERAV

Enzyme Prediction     

No EC number prediction in MGYG000003486_01348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	93	1.3e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.46e-18	1	133	81	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	4.27e-17	17	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.05e-14	1	102	45	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEI32690.1	2.61e-78	2	238	4	241
QHB22025.1	2.61e-78	2	238	4	241
QRT31727.1	2.61e-78	2	238	4	241
AAK20704.1	3.06e-75	1	238	1	236
CAI32956.1	3.06e-75	1	238	1	236

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003486_01348.