CAZyme Information: MGYG000003486_01684

Basic Information

• Species: CAG-95 sp000436115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp000436115
• CAZyme ID: MGYG000003486_01684
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
561		64439.56	6.701

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003486	2822689	MAG	Fiji	Oceania

• Gene Location: Start: 12468; End: 14153 Strand: +

Full Sequence      

MTTMTKKDYYCLSALMLIFTILVFFRLGNTYAPQSAYTADENNRDIVLDLGDYLDVSSIS
IFLGNLDTRHFSISAFNEVTGQWEVFNGEASAGSVFAWNKIDINYNLRYLGIVCTDDTAV
LNELVVQGADGSILLPVNADTYPELFDEQEMFPSVKTYMTGTMFDEVYHGRTAYEFLHGL
TTYETTHPHLGKILISMGILGFGMTPFGWRFMSAFFGILIIPVMYLFAKKLLKNTYLATA
TTALLVFDCMHFTLSRIATIDIFAAFFILLMYYYLYQYFTADQAYRKNRNALTDSFPPSS
VYTPLALCGINMAFGIATKWTGVYAGLGLGILFVWYTLMNFPKKQWTRLLGFCCVFFIAI
PLIVYTLCFIPVVGYTPYKNLLDKVISGTQYMFHYHSTLVAEHYYSSPFYEWPVIWMPLL
DANDAVNATDVSAVSCMGNPAIWWFGIPCVLYVFFRWIFKKDKKAGFLCIAYLAQYVPWM
SVSRITFIYHYFPAILFVILMMGYTMADIKEHFVWGKKAITTYLVIAIICFFLFYPVVSG
FPIYKEWGLRLRWLPDWILVL

Enzyme Prediction     

No EC number prediction in MGYG000003486_01684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	161	371	1.4e-51	0.905829596412556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	2.76e-23	392	555	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	2.16e-22	377	559	493	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.48e-15	164	369	50	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	2.77e-12	164	369	23	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	7.27e-12	180	412	129	320	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF42044.1	1.39e-138	5	560	347	921
BCN30459.1	4.12e-134	5	560	488	1059
QNM01664.1	7.74e-112	5	560	482	1086
AQZ49137.1	3.95e-100	6	557	469	1049
AVF24955.1	4.14e-100	6	557	472	1052

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.65e-27	163	557	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.65e-27	163	557	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	9.37e-27	163	557	66	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.07e-15	187	557	99	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997885	0.002075	0.000024	0.000004	0.000003	0.000021

TMHMM  Annotations     

start	end
10	29
206	228
257	276
296	318
322	339
352	374
440	459
485	507
522	544