CAZyme Information: MGYG000003488_01695

Basic Information

• Species: CAG-488 sp900554995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp900554995
• CAZyme ID: MGYG000003488_01695
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		82129.95	4.9242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003488	2291044	MAG	Fiji	Oceania

• Gene Location: Start: 242896; End: 245073 Strand: +

Full Sequence      

MNHREIFSDARWLSPRQSLDAALFRSEIEISRTVQSAEITICGLGWFILYINGRRVGNDE
FVPSYTDYHDRPDMNLSYPLNDDFSHRIYALKYDVSEYLHEGKNILGVAVGGGYYHQTLR
KAEGNMNYGNIKLCYKLDVDSEVFYSNRKDVRYSRGYFEKSNLFYGETLDFRGFDRKWST
VDGNLSDGEEPFETAPPKTEYYIQDCPTDKVAEVLAPELVKNFGDFSVYRIGKNISGYPV
IRCGNEGETVVIECAEDLNDDLTLNNRSVGFNVQKQSEIIKTDSGEFFHPVFCWFGFRYF
SLTNNADPVEVRVIHSDVEVTSDFYCSDETLNWYYKAFVNTQLSNMHSGVPSDCPHRERL
GYTGDGQLTCNAVLTEFDAERFYRKWLLDILDCQDKNTGHVQHTAPFAGGGGGPAGWGGA
IINVPYQLFRHFGKRDELEKVFPSMEKFADYIESRCENGLIVREEKDGWCLGDWCAPERI
SVPEDLVNTTMFISQLRRLVFCAKALGKQYDRYEKLISEHSAAITEKYFDEETGDFFNNV
QGANAFALDCGLGNAKTLENIIKKYSEKTEFDTGIFGTETVLNVLYKTGNGDLATKLLSN
KGDVSFDFMRRSGATTLWENWGGEESHSHPMFGASTEFLFEKLLGIKQAASSVRYDQIII
SPVFAECLNYAKGKIKTPHGEVAVSWKREDGKINLNIAVCDGINATFVNGSTKINLHTGN
NNIIL

Enzyme Prediction     

No EC number prediction in MGYG000003488_01695.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	228	706	5.2e-113	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.04e-65	321	641	3	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	6.16e-25	34	213	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.27e-09	228	315	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.95e-07	655	708	9	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	9.83e-200	7	707	3	706
QOY86540.1	1.41e-136	24	699	154	832
BCJ98018.1	1.93e-130	12	699	127	848
QUT50058.1	8.20e-112	10	719	142	868
QIA06287.1	1.20e-105	21	708	171	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.20e-76	21	699	176	888	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.22e-56	32	699	314	984	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.80e-44	24	686	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.86e-69	21	725	184	933	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.68e-55	32	699	314	984	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.77e-49	13	708	160	877	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	7.48e-45	25	699	178	868	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998047	0.001916	0.000024	0.000003	0.000002	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003488_01695.