CAZyme Information: MGYG000003489_00363

Basic Information

• Species: Prevotellamassilia sp900768625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900768625
• CAZyme ID: MGYG000003489_00363
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45672.54	8.6769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003489	2843857	MAG	Fiji	Oceania

• Gene Location: Start: 11521; End: 12720 Strand: +

Full Sequence      

MMLFCNVVSIFNRKIRTMMQGHRNTWRILRQHVKADERYVWFHAASLGEFEQGRPLMERL
RREHPERKILLTFFSPSGYEVRKDYAGADIVCYLPFDTPLNARKFVRMAHPEAAYFIKYE
FWRNYIEVLHHHDIPCFSVSSIFRPGQVFFRWYGRGYARVLHRMTHLYVQNDESRRLLEG
IGVNHVSIVGDTRFDRVIDIRKAAKPLPLVERFAGCWRVLVAGSSWAPDEDVIIPYFNSH
SNLKLVLAPHVVSEDHLRQIEQKLSRPFVRYSAATPKSVAEADCLIIDCYGLLSSIYRYA
TVAYVGGGFGVGIHNVPEAAVYGVPVVIGPNNEKFREAQALLRLGGCCEIHSADDFAALM
DRFLSDKEFLRKAGEASSSYICENAGATNLIMQGFQTAP

Enzyme Prediction     

No EC number prediction in MGYG000003489_00363.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	34	196	1.5e-43	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	4.53e-61	29	394	41	414	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
PRK05749	PRK05749	1.22e-58	30	396	32	418	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
pfam04413	Glycos_transf_N	4.01e-51	27	196	3	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
COG0707	MurG	0.010	318	385	267	343	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA73413.1	6.43e-183	7	393	16	402
QJR57019.1	6.43e-183	7	393	16	402
AII67616.1	6.43e-183	7	393	16	402
QJR58185.1	6.43e-183	7	393	16	402
QJR75178.1	9.12e-183	7	393	16	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.83e-28	40	381	43	364	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66663	7.20e-28	40	381	22	343	3-deoxy-D-manno-octulosonic acid transferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=kdtA PE=1 SV=1
Q45374	9.43e-22	40	396	55	424	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1
F0T4D1	9.82e-22	40	348	61	379	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydophila psittaci (strain ATCC VR-125 / 6BC) OX=331636 GN=waaA PE=1 SV=1
Q9ZE58	2.44e-20	6	371	57	429	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1
Q9PKI5	4.06e-19	24	388	37	413	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003489_00363.