CAZyme Information: MGYG000003489_00651

Basic Information

• Species: Prevotellamassilia sp900768625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900768625
• CAZyme ID: MGYG000003489_00651
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1212	MGYG000003489_104|CGC1	135128.95	6.153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003489	2843857	MAG	Fiji	Oceania

• Gene Location: Start: 239; End: 3877 Strand: -

Full Sequence      

MTSRSFIMKIVAALLLIIGLADRKATAQVVENPKVVCDLLDRIGGAGTAERILTVIDPAV
ASAGKEAFVLMAQDGKPCIKGSNVSALTTGVNWYLNHVAHVNIAWNNLTTDLSKVELPAP
TKQEKHTTAVGYRYYLNYCTFSYSMSTWTWERWQKEIDWMALHGINMPLQMVGLDVVWKN
LLTKDLGYTDDEANAFIAGPCFQAWWGMNNLEGWGGKNPDWWYKRQEDLAKKILAREREL
GMEPVLPGYAGMVPSDIAKKGFAANNQGNWCGFTRPYILDPNTQAFSDISEKYYARLEEL
MGISTYYSMDPFHEGANTSGIDVASAYKRIGDAMLKTNSKAKWVIQFWQWSEAQYHVLSQ
VTKGKLIVLDLFSDAHTHFGEYNGHDAVYCMLPNFGGRTGLFGRLTKVMKNFYTQKSSFA
NVKGIGATPEAIEQVPVLYDALFELPWRSSAPSAQTWLKDYTVARYGTTDEMAQKAWEQV
RNSALNCETALQGPHEAVFCARPSLTVDRVSSWGGTGIFYDPQMMVGAAHNLLSAQLTGT
NYNYDLTDFTRQALTDYGLSLLAAINEAANNPNNKEAYANRRDNYLQLMLDLDELLSTNE
NFMLGRWTNMARSIADEAEGTTEADRKWLELNNARTLISTWGDENNSEAGGLHDYSYREW
GGMMKDFYYPRWKAFFDNRDKGKALPNWFTNDWKWAHNAALSYSNKPVGNTAETATRLLG
KYFTSLEKADGKPYYIYRHMATDATSSLVFSAIRGEKFTLPLTALTDGTSVTLGIDLNND
GTLADSETTGAPDMDIPETAICGKVKAVLTFSDGTQLTFSVILKDNITEARTVTVKSADT
KQGSVKITGSTVLSVTNAKEVTMRAIPAKGCEFLNWTDASGRVVSTENPYTYYGAAPETF
TAHFFADKWGTPQENMADYNDMKSYGQYLRSLTVSQNGGKEKSLYATSDCPESLCQTTQT
VQAPQGSRFKLHWLSAGGLNYCRLSAYIDLDGDGNFKGKEEVLEIYGTKGSAGNNALNDH
TLTVTLPYNMPLGITRIRLRFDSSWASGWDSQTDGMPAKSETKRMVYDIPVMVTDKAAEA
CTVTVKSANQKQGTADANGQPDTYTYRAGEEIVLRAYPADGFAVDYWTDSYNRHVPQTWM
DGNFLRFYAPESGTYTVHFKPYTPDGINTPANDDNKQPSAVYDLQGRRIGNGHWQHLPSR
ILIVDKHKRISK

Enzyme Prediction     

No EC number prediction in MGYG000003489_00651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	719	5.9e-196	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.12e-156	133	449	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.84e-75	457	715	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	3.30e-14	38	120	5	79	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	2.77e-227	26	727	16	722
QQT77518.1	5.25e-192	39	699	29	704
QRP57238.1	5.25e-192	39	699	29	704
ASM65926.1	5.25e-192	39	699	29	704
ALJ43270.1	1.35e-191	14	727	7	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	2.70e-116	74	715	211	873	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.24e-116	74	715	219	881	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	3.23e-115	74	715	234	896	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.87e-88	39	723	12	712	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	2.35e-87	39	723	35	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	5.86e-86	61	723	73	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000227	0.999102	0.000174	0.000175	0.000167	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003489_00651.