CAZyme Information: MGYG000003489_01538

Basic Information

• Species: Prevotellamassilia sp900768625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900768625
• CAZyme ID: MGYG000003489_01538
• CAZy Family: GH51
• CAZyme Description: Extracellular exo-alpha-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		73757.04	6.5063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003489	2843857	MAG	Fiji	Oceania

• Gene Location: Start: 1679; End: 3643 Strand: -

Full Sequence      

MTPHSVMKRFITASLLSAAAILGLQAQEASVTMEVNLSRPIAQADDRMYGVFYEDINFGA
DGGLYAELVKNRSFEFPQHLAGWMPFGQVSVENASPCFERNPHYVRIVSHGELTGSGLEN
EGFRGIGLKRGATYRFSVYARSPKAQSVPVNVELIGSNGATLCRQTLHVSSSDWKAYELT
FESPATEAHARLRVVMRQSGTVDLEHLSLFPTDTWKGRPGGLRRDLVEALRDLHPGVLRF
PGGCVVEGNSLATRYQWKNTLGRVENRPTNENRWNYTFKDRAFPDYFQSYGLGFYEFFQL
CEDIGARPLPILSVGLSCQYESHEQVCLDSLQPYIQDALDLIEFANGPASSRWGKVRAEM
GHPAPFGLEFIGIGNEQWGPEYVERLEPFIRAIRRSWPNVKIVGSSGPSADGDKFDYLWP
EMKRLKADLVDEHYYMEPEWFLRNASRYDHYDRRGPKVFAGEYAAHDHSAGKANNFRAAL
AEAAFMTGLERNADVVRLATYAPLFAHVDAWQWNPDLIWFDNLRSFRTPNYYVQQLFALH
AHSQIMRIETPDGQPLTGQKDLYASASRDAQTGTTVLKIVNTAHHPSSIAIRFNGSRRHP
SQGVCTFLQADDLNVVNDFDQERIAPHTMPVRVDADGVLRMELPANFFGVFELH

Enzyme Prediction     

EC	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	193	652	4.2e-111	0.692063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	3.57e-56	204	628	26	473	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam06964	Alpha-L-AF_C	6.35e-46	461	646	1	191	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	1.79e-43	461	646	1	188	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam02018	CBM_4_9	1.05e-11	66	200	1	134	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT64856.1	4.72e-311	7	653	1	642
QUT62334.1	4.72e-311	7	653	1	642
QUT33915.1	4.72e-311	7	653	1	642
QQA30837.1	4.72e-311	7	653	1	642
ALJ58902.1	5.38e-311	14	653	6	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.43e-86	31	631	1	604	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2VRQ_A	1.01e-15	221	653	51	493	StructureOf An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_B Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_C Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus]
6ZT6_A	1.34e-15	221	653	51	493	ChainA, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
3S2C_A	1.70e-15	221	549	48	374	Structureof the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
4ATW_A	2.97e-15	221	549	48	374	Thecrystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_B The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_C The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_D The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_E The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_F The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	6.58e-135	42	570	46	573	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q9SG80	5.97e-101	30	653	40	655	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	1.03e-95	27	653	36	652	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
B8NKA3	3.29e-70	32	654	32	629	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
Q2U790	1.23e-69	32	654	32	629	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000417	0.998703	0.000270	0.000206	0.000207	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003489_01538.