CAZyme Information: MGYG000003489_01656

Basic Information

• Species: Prevotellamassilia sp900768625
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900768625
• CAZyme ID: MGYG000003489_01656
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1158	MGYG000003489_279|CGC1	130006.11	6.5381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003489	2843857	MAG	Fiji	Oceania

• Gene Location: Start: 5552; End: 9028 Strand: +

Full Sequence      

MKYIHHILLIVTVTIMGCHALCMQAAKKNPQAVSALLNRIGGKGTADRFVTIVDASLASS
DGLDQFVITSFEGKPCIKGSSKLAVTTGINWYLNHTAHINLTWNRLTTDLTKATLPLPEG
EEKHKCSVPYRYYLNYCTFSYSMSSWTWERWQQEIDWMALHGINMPLQIVGLDVVWHKLL
TQDLGYSEKEANEFIAGPCFQAWWGMNNLQGWGGPNPAWWYKRQEQLCKQILKRQRELGM
DPVLPGYSGMVPSDIASKGLKANNQGNWCYGFVRPYILDPNTSSFSEISAFYYKRLKEVM
GTSPYYSMDPFHEGANTSGIDVASAYRKIADAMTKANSKGKWVIQFWQWSSDQYHVVEKV
EKGKLIVLDLYSDAHTHFADYNGHDAIYCMLPNFGGRTGLFGRLTKVMEQFYVEKATHPN
VKGVGATPEAIEQVPVLYDALFELPWTSQRDAKKWLADYAHSRYGKKNSHAERAWELLRR
SALACPTSLQGPQEAVPCARPALTVNAVSSWGGTELFYDPQDVVEAAFQLLEARHQLSGA
NYSYDLTDVTRQALTDYANLLLKAIHSAYTKKDLTAYARSRDAFLQLVLDLDELLNTNAN
FMLGRWTNMARHIADEVPGTSDADRRWIELDNARTLITTWGERDMSETGGLRDYSYREWG
GMMKDFYYDRWKKFFDALDAGNEQPDWFSHDWNWAHNASLSYSDQPTGQTAEVAERLLLK
YFATFTSTNATTSRINRKYATDATSRLSDVAFRGTSYALPLQGIKANELETVCMDFDANG
SFTDNETFRSMHISIPAHATLGRTKALIRLTDGTQFTYSLLVKDKVGKARTISVETAETS
QGKATLKGTATNSLTTTADITAMATPTPGYDFYHWTDAEGHIVSTDNPYTYYGATDLRLK
ANFIRNKWGSPQEDANERSVIQSYGQYITTLEASQSGREPLMLFSATASPDRLFQSTQMI
EAAKGSRVSLHWTSAGGLNYCRLSAYADLNADGDFCDEGELIAVYGEKESGNNTALNDYT
LHVLLPYDIPEGPTRIRLRFDGSWAKGWNDATQAMPADATTQRMVYDIPVNVTRQASFPC
TVTVESADAVKGTVDANGQPDTYTYGVGEEIVLRVYPAKGQKVKGWTDAYGRNVPASWRD
GNFLRFRAPESGTYTVRF

Enzyme Prediction     

No EC number prediction in MGYG000003489_01656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	718	4.2e-200	0.9909502262443439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	3.03e-155	131	448	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.50e-83	455	714	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	2.56e-14	31	116	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	5.14e-244	18	722	10	718
ADV42401.1	4.99e-192	33	717	22	711
QCQ44686.1	9.91e-192	33	718	23	714
QCQ35767.1	9.91e-192	33	718	23	714
QLK82076.1	9.91e-192	33	718	23	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.04e-123	25	712	166	864	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.26e-123	25	712	174	872	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.30e-122	25	712	189	887	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	3.70e-102	32	722	8	712	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	4.93e-101	32	722	31	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.50e-99	62	722	76	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000613	0.337253	0.661617	0.000178	0.000167	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003489_01656.