CAZyme Information: MGYG000003490_00001

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000003490_00001
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		39326.88	5.2418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003490	2488924	MAG	Fiji	Oceania

• Gene Location: Start: 723; End: 1772 Strand: +

Full Sequence      

MAGIIYDRQRVLSAIDAVAEQTMNMDMPWDWPCGVAYFGMCEASRVTGDDKYIEMVKARV
DEYIELGLPHWTVNTCSMGHCLLSLHEKYGDERYKKIAGEKINYLRHEALRFGDNVLQHT
VSAKNDFPEQCWADTLMMAAFFMLRAGVAWGDAELIDDALNQYYWHIEYLQDKKTGLWYH
GYNNITRDHMSGFYWGRANAWAAYTMSKVGVVLPECYLYPKYMDVAGALAEQLSALKKLQ
TEDGLWRTLLDDPESYEEVSASAAIAAAMVIKGNPLHLKYVNKAVEGILNNISPEGRVLN
VSAGTAVMKDRDGYRNISRRWTQGWGQGLALAFLAAVLEADKLAVDGAL

Enzyme Prediction     

No EC number prediction in MGYG000003490_00001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	337	2.6e-80	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.36e-82	1	328	6	340	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.39e-68	22	328	20	330	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97580.1	1.26e-193	1	349	1	349
ADL32982.1	1.39e-190	1	349	1	349
BCJ94220.1	3.44e-184	1	349	1	349
QEI31009.1	1.55e-180	1	349	1	349
QHB23517.1	1.55e-180	1	349	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	6.87e-37	29	339	66	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.03e-36	29	334	47	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	1.32e-34	29	339	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4CE7_A	1.12e-07	6	298	28	333	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.22e-114	1	342	1	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	6.22e-07	6	298	35	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003490_00001.