CAZyme Information: MGYG000003490_01630

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000003490_01630
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		43996.87	5.0561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003490	2488924	MAG	Fiji	Oceania

• Gene Location: Start: 1174; End: 2388 Strand: -

Full Sequence      

MTGNNVEVENLTIRNDAGDGREVGQAVAVYAAGDRGVWRNCRMIAAQDTLFCGPTMPKVA
RDALPRLIPEGVPSVGDCPPVPGRQYFEDCWIQGDIDFIFGPYRCWFERCTLFMNERGGF
YTAANTPQGMPCGMVFHRCRLTGACAPGQAYLGRPWRAHAQTVFLDCEMDECVSPQGFAD
WEGGAPVTDLYGEHGTRGARADQSARHPKQKRLTDAEAARLTLRAALGGCDRWQPDRRTP
TWFVCGDESTRPWADTLSCLAEDAFVEDCTLDGASGKSFVAGKRLSFVELCLRKGDKLLV
QFGRADQQKDVRVSTAARATFPLYMNMMIDAARRQGAEPVLVTPIGAADGEYAAALRGLA
QERGVRLLDMAALLPAGEGSDPAMWQAAWLLAALSALRGGDAED

Enzyme Prediction     

No EC number prediction in MGYG000003490_01630.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	226	5.9e-56	0.6875
CE12	251	373	1.9e-18	0.6428571428571429

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.84e-39	3	202	188	380	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	9.90e-34	10	229	93	297	Pectinesterase.
PLN02432	PLN02432	1.02e-32	11	229	101	288	putative pectinesterase
PLN02990	PLN02990	9.97e-29	1	240	344	566	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	3.91e-28	3	221	101	290	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE68949.1	8.74e-106	2	236	91	327
ANY70879.1	1.91e-53	9	238	95	327
QOV20146.1	7.15e-53	1	228	88	315
SET76962.1	3.02e-52	9	235	96	321
QNM04098.1	7.58e-52	9	235	109	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	5.91e-17	10	206	105	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.91e-17	10	206	105	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.82e-16	8	229	94	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	6.85e-15	10	206	100	278	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	4.08e-12	1	235	93	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	2.92e-24	1	240	341	563	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	9.51e-22	1	218	99	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FJ21	6.69e-21	1	240	343	565	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q9SIJ9	1.85e-20	11	251	141	347	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9ZQA3	3.24e-20	5	233	177	384	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003490_01630.