CAZyme Information: MGYG000003490_01683

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000003490_01683
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		35089.37	5.0983

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003490	2488924	MAG	Fiji	Oceania

• Gene Location: Start: 62; End: 1015 Strand: -

Full Sequence      

MQTILVQPGENALQAAIDSLPRDDTPVTLHLTPGTYREKITLSRANTTLEGEDAASTVIL
WDDGASEMMPDGLKRGTFRSYTMLMDADHVTLRRLSIVNAAAPREKVAQAVALYADGDFF
TCEDCVLSSFQDTLFTAPLPPKEIQKNGFLGPKQFAPRRPQRHTYRRCRISGDIDFIFGG
AAAWFEDCDIVCVDGREDRTAPGGGFATAASTPEGQKYGYVFRSCRFLGEGVADGSFYLG
RPWRDWAKTVLLDCHIGPHIRPEGWDDWGKPHAREVSFFAEHGCTGPGSEGQRAAWAHRL
TDEEAAAITYEDFMRSL

Enzyme Prediction     

No EC number prediction in MGYG000003490_01683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	13	314	4.1e-79	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.97e-60	13	304	97	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	2.57e-51	13	305	85	352	pectinesterase family protein
PLN02432	PLN02432	8.44e-50	13	314	26	286	putative pectinesterase
pfam01095	Pectinesterase	1.49e-44	13	315	15	296	Pectinesterase.
PLN02773	PLN02773	5.28e-42	7	314	11	296	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC03567.1	1.67e-103	12	314	23	322
QIX89293.1	4.82e-99	22	314	40	340
QRP39805.1	2.00e-98	15	314	33	341
ASN95501.1	2.00e-98	15	314	33	341
QJU20267.1	7.33e-98	22	295	41	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	3.31e-29	11	300	45	349	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.58e-26	16	309	24	329	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	3.77e-25	4	306	6	289	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1QJV_A	6.39e-22	16	309	24	329	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
2NTB_A	6.39e-22	16	309	24	329	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FM79	3.22e-36	13	314	95	372	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	3.52e-34	13	305	99	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9SIJ9	2.83e-33	13	314	64	326	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9LVQ0	7.46e-33	12	314	19	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	2.09e-32	13	316	304	594	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003490_01683.