CAZyme Information: MGYG000003490_01685

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74
• CAZyme ID: MGYG000003490_01685
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41478.45	4.6629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003490	2488924	MAG	Fiji	Oceania

• Gene Location: Start: 158; End: 1252 Strand: -

Full Sequence      

MHMNLSAELLRSRLACLVEAFCPILYEDDEIFLENMKDRNLAGDDIRRYQHWEWTQGVGL
YGLWKLYAATGEARYMDILTRFFDQQLAIGFPALNVNTAAPFLTMALVGERLQEEKYLSP
CRDSARWIMERFPRTEEGGFQHMTSDTLNEQELWDDTLFMTVLFLATMGRIEGNQAYIDE
AQRQFLLHEKYLACPDNGLWYHGWTFKGRHNFAGAFWGRGNCWITIAIPELLSMIPCDEA
VRADLTRALARQAESLRNYQDEGGMWHTLVDDPTSYVEASATCGFGYGLLKGVHMGLLDP
AYKEVALKALPPVLDCIGADGVVQQVSYGTPMGRESRDFYKNIELKPMPYGQALAILFLI
ECLA

Enzyme Prediction     

No EC number prediction in MGYG000003490_01685.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	362	5e-105	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.06e-111	36	364	10	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.41e-99	45	363	20	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET92327.1	6.25e-172	8	361	2	355
QOV18383.1	4.92e-168	19	363	20	364
BCJ96760.1	1.02e-167	17	361	16	360
QQR00386.1	2.47e-166	18	362	16	360
ANU44854.1	2.47e-166	18	362	16	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	2.24e-94	45	363	59	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	3.47e-93	45	363	58	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.25e-88	6	361	5	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	4.00e-25	44	344	31	345	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.71e-24	44	344	21	335	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.63e-55	52	363	29	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	2.19e-24	44	344	31	345	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	1.56e-14	154	328	201	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	9.25e-11	160	309	1	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	9.25e-11	160	309	1	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003490_01685.