CAZyme Information: MGYG000003491_01621

Basic Information

• Species: UBA2804 sp900768635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; UBA2804; UBA2804 sp900768635
• CAZyme ID: MGYG000003491_01621
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41038.53	4.8854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003491	2438052	MAG	Fiji	Oceania

• Gene Location: Start: 351; End: 1424 Strand: -

Full Sequence      

MNNMRCCGIIEGYFGTPWSMEDRLSYPSFMAEYGYSFFIYAPKNDLFLRKSWDKPWNEDY
LAGLRKLKEAFNKKNIDFGIGYTPAGQASEIAGHPEQLQERIREMDKELHPDYFALLFDD
LKNNDADRLAYFQLQIADKVFQELSGVKRFIVCPSYYSFDPVLDRVFGVRPKSYWEEYAG
GLDPHTDIFWTGEKVCSSGFSAEHLLQVAEIFGRKPFLWDNYPVNDGKKLADYLFLEPFS
NRGPEICELTSGHGINPMREPLVNKLVLATLPFSYRGKSLTHASPEYWELSEKILGSGTT
CQLRQDCEIFARIGRASLDQDKLADLTEIYNRIGTPSALEICRYLKGDYAFDPDCLT

Enzyme Prediction     

No EC number prediction in MGYG000003491_01621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	7	283	1.4e-70	0.911864406779661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	5.26e-63	7	271	1	258	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF19540.1	1.13e-98	8	357	18	366
ANT68635.1	1.13e-98	8	357	18	366
BCK64048.1	4.52e-98	8	357	18	366
QSR52475.1	4.52e-98	8	357	18	366
QSR76417.1	4.52e-98	8	357	18	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DIY_A	5.34e-38	1	333	1	331	Thermobaculumterrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum],5DIY_B Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum]
6PV5_A	1.38e-34	9	311	191	487	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2XSA_A	3.61e-30	8	264	4	262	ChainA, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516],2XSB_A Chain A, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516]
7KHS_A	3.69e-30	8	264	6	264	ChainA, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_B Chain B, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_C Chain C, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_D Chain D, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516]
2XPK_A	9.84e-29	8	350	153	500	Cell-penetrant,nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens],2XPK_B Cell-penetrant, nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2CEE3	1.97e-29	8	264	4	262	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
Q8XL08	3.92e-27	8	350	183	530	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	1.30e-26	8	350	183	530	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
O60502	4.16e-26	7	276	62	333	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
Q8VIJ5	4.16e-26	7	276	62	333	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003491_01621.