CAZyme Information: MGYG000003493_01953

Basic Information

• Species: Prevotella sp002299275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002299275
• CAZyme ID: MGYG000003493_01953
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		65147.15	4.5872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003493	3028354	MAG	Fiji	Oceania

• Gene Location: Start: 35773; End: 37569 Strand: -

Full Sequence      

MKKAILTLFCAITGMSSMAQQLAFPEAEGYGKNASGGRGGNVYYVTRNDDCTDDNLVEGT
LRWALRTGDDTPRTILFKTCGTIYLTSQLKFAHPNVTIAGQTAPGGGICIAGYKVYVCKP
NVILRHLRFRAGDYASKSMPSLDVENTNNVIIDHCSFTWSMEECLTMYDCDSTTVQYCII
GEGLYNSRNSKGARAYATQWGGEHSTMHHCLITNCNNRTPRFNGVRDNSNNPGDHDQFVD
SEFFNNVIFNWGKPNSVYGGECDTTINSGNSYNRVYMRGNFFRPGPATLQNVKSNRYFVE
ASTQNGMGQWLLDGNKFDVSSPFTPTTAVWAESVLSQIEEDNYYGISTGNAGRTINVKSG
TNADFLLNNVLSTQEQSSGLLAESADDAFSKVVSTAGASLPRYDEVDIRLLDEASGKINP
QYAGYEASGSLSRAMGIINSPSDITLSRHDVFIAVKESDTGEKQNVEATEWPYLGLEDGE
KGFTDTDSDGLPDAYEEEIGLDPTNPLDGANIGADGYSNLELFLNGVAEGSIDKAKYEDK
DISSISSVLPDASDAVHETVYGVNGAIIQGFKPGIGIVRQTMSDGRTRVNKVLMSPRR

Enzyme Prediction     

No EC number prediction in MGYG000003493_01953.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	81	272	1.2e-61	0.9836065573770492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00544	Pec_lyase_C	0.002	95	224	35	178	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
smart00656	Amb_all	0.007	95	222	17	151	Amb_all domain.
pfam18884	TSP3_bac	0.010	485	506	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75604.1	6.74e-142	20	595	35	604
ALJ01754.1	1.49e-94	8	528	3	461
AEV99914.1	2.17e-88	7	527	11	468
QGW28869.1	3.90e-86	2	525	3	457
AKP52263.1	5.17e-86	1	527	1	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	1.70e-06	5	251	11	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B297	1.01e-33	7	530	6	414	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q0CLG7	1.01e-31	6	531	5	417	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B8NQQ7	3.45e-31	22	531	21	417	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.36e-29	22	531	21	417	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	8.57e-29	22	527	22	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.998975	0.000183	0.000188	0.000171	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003493_01953.