CAZyme Information: MGYG000003493_02199

Basic Information

• Species: Prevotella sp002299275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002299275
• CAZyme ID: MGYG000003493_02199
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36862.81	6.6774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003493	3028354	MAG	Fiji	Oceania

• Gene Location: Start: 24407; End: 25387 Strand: +

Full Sequence      

MKHFIFYRLFILGLLTSAVCLSAEARGKYDNTDTIVVARDGTGQFRSVGEAVEVCRAFME
YRKVIFVKKGVYKEKVVVPSWLTNIEIVGEDRDKTVITYDDHANVPLKETGLPMGTFRTY
TVKIEGCDITLRNITVENNAERLGQAVALHTEGDRLTFVNCRFLGNQDTVYTGMQNTRLC
FEDCYIEGTTDFIFGPSTAWFENCEIRSKSDSYVTAASTPADIQYGYVFCHCRFTADEGI
TKVFLGRPWRAYAYTVLLNCELGGHIVPEGWHNWKDYHDPAAERIVRYGEYGSTGNGANP
KGRVEWSHQLSAKEAKAITKERVLNI

Enzyme Prediction     

No EC number prediction in MGYG000003493_02199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	35	324	1.6e-100	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	4.22e-72	35	319	2	290	Pectinesterase.
PLN02773	PLN02773	3.91e-68	37	315	9	287	pectinesterase
COG4677	PemB	1.23e-65	35	319	84	397	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.92e-65	34	316	70	353	pectinesterase family protein
PLN02432	PLN02432	2.53e-57	35	323	13	286	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	6.66e-159	14	323	6	314
QVJ81978.1	7.26e-153	14	325	5	315
ADE82952.1	7.26e-153	14	325	5	315
AGB28242.1	1.24e-151	14	325	8	316
QJR97878.1	1.25e-145	29	326	16	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.00e-40	35	306	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.57e-39	36	318	6	290	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.37e-33	35	324	11	287	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.31e-32	35	324	11	287	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.78e-25	64	324	36	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.63e-50	32	315	4	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	9.59e-48	25	316	75	367	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	1.33e-46	34	325	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9FM79	1.34e-46	35	316	82	364	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q42608	1.55e-46	34	325	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001237	0.593301	0.404490	0.000469	0.000254	0.000216

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003493_02199.