CAZyme Information: MGYG000003496_01454

Basic Information

• Species: CAG-115 sp900768705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp900768705
• CAZyme ID: MGYG000003496_01454
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44177.17	4.1942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003496	2237307	MAG	Fiji	Oceania

• Gene Location: Start: 44208; End: 45404 Strand: -

Full Sequence      

MKKRILAAVLACITALGVAGCAKNENSGASVSSDSAGTSSDASNTSSGDSSTASEDSGAS
SGESGDSSAESESSDGNTGASEHKYKLSNPNATESAAKVYDYICENFGKTMMAGQQESTW
NDGNNPDYEMEMIESWTGKLPAVRGFDFMKEEWDDIVTRATAWWEKGGIVTICWHTGINS
MGTDGYKSSYEDVADWDKLFDENSEEHKAMLAHWDDAAAALARLQDAGVPVLWRPFHEFD
GDFFWWAKGENGEKTDDGQYLTKLWKMMYDYYTNEKGLNNLIWVYGYGGTVKEGWYVGDE
YCDIVGSDRYSYREDPTNKEGWAKLLTNATETKPFAYHECGNLVSSSKFEEDGAIWSWFM
SWHSSYAEANVGKRFGEDTKELYNSELVITLDELPSFK

Enzyme Prediction     

No EC number prediction in MGYG000003496_01454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	88	393	4.4e-82	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.51e-37	89	393	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.54e-13	228	341	179	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	2.87e-82	84	397	3	299
ADU20874.1	1.18e-78	87	395	167	460
AWB26443.1	9.03e-66	87	395	48	337
QQQ74226.1	4.15e-59	89	398	175	469
AAK19890.1	6.81e-57	89	398	208	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WDQ_A	8.58e-48	90	397	37	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.42e-42	84	398	42	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3ZM8_A	1.02e-38	87	398	145	451	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	1.03e-37	89	394	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HPF_A	2.50e-35	89	394	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	6.69e-41	87	398	174	480	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	5.12e-40	86	398	145	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55297	2.67e-34	87	397	158	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	3.59e-34	87	397	156	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	1.66e-33	87	397	157	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000092	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003496_01454.