CAZyme Information: MGYG000003497_01042

Basic Information

• Species: RF16 sp900768725
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900768725
• CAZyme ID: MGYG000003497_01042
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000003497_154|CGC1	44876.35	4.7623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003497	1691378	MAG	Fiji	Oceania

• Gene Location: Start: 19579; End: 20748 Strand: +

Full Sequence      

MSITQFFQKTLFVCVLAGCCLSCENPNANGGGEVNPPDTTVTNPKDTVPVEVVDTTLYDC
DALCTPSPSPETQKVYRFLRQIYGRKILSGAMACVNWNVNEAEWVHYHTGKYPATTCFDL
IQATMTDQWAKNTYASYAVYEDWWKNHGLVQGMWHFMVPKTESTTTTSSSATYKPEETTF
RAVNVPKEGTWEHTLFVENIDIVARILQGFQERHIPVIWRPFHEAAGGWFWWGKDAEAEV
WMWRYMYDRFVNHFGLNNLIWVWTTQGSDAAWYPGDEYVDIVARDLYKKSQAQSSYSYFA
YDEMMYPNKMLALSECGSVAPIGEQWEAGAKWLYFMPWYDTKRSSSTSPNSIYFTDTTTP
HEHAPIEWWKAAWEQPNVLSREDLPSFAE

Enzyme Prediction     

EC	3.2.1.73	3.2.1.78	3.2.1.4	3.2.1.8	3.2.1.151

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	65	381	3.9e-84	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.81e-43	65	351	2	295	Glycosyl hydrolase family 26.
COG4124	ManB2	4.40e-15	194	287	154	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW58761.1	9.24e-99	63	386	45	368
QRQ58989.1	7.15e-93	63	387	45	359
SCV06948.1	7.15e-93	63	387	45	359
ALJ47537.1	7.15e-93	63	387	45	359
QGY44077.1	3.34e-90	63	386	136	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	3.36e-94	63	387	45	359	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	1.50e-72	63	384	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	2.34e-68	63	384	95	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	5.17e-47	65	387	36	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	2.40e-44	63	386	145	466	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55298	1.04e-42	63	387	156	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.06e-42	63	387	158	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
G2Q4H7	2.85e-42	62	341	173	448	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.20e-41	73	340	156	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	1.52e-41	63	387	157	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003748	0.124611	0.870176	0.000479	0.000629	0.000339

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003497_01042.