CAZyme Information: MGYG000003497_01283

Basic Information

• Species: RF16 sp900768725
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900768725
• CAZyme ID: MGYG000003497_01283
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000003497_195|CGC1	44918.95	4.8088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003497	1691378	MAG	Fiji	Oceania

• Gene Location: Start: 5568; End: 6755 Strand: +

Full Sequence      

MKKTILILFAALVVVGCGRTSEPTATDYLAKTVRVAQSEIQHNPELWMADFLKAPKWDYT
QGLIAKAMLETYLATGDSVYLNYVQAFADYFIQPDGNIKTYKLETYNIDRVNGGNFLFLL
DSLNPQPQYKEAIRLLRSQLATQPRTSEGGFWHKKVYPWQMWLDGLYMGEPFYAHYAVWA
GEDTIFNDVVRQFRVVDKHTLDAETNLNFHGWDESRQQAWADSLTGCSPHTWGRAEGWYV
MAICDVLDYLPAEHEGRTELIAILNRVCEALLPLQDAETKMWYQVPDLPEVEGNYTESTC
SAMFCYAMAKGARMGYLPTKFRTIARETYDGIWKSAVVENEEGTVSLTRCCAVAGLGGNP
YRSGEYDYYIHEQIRDNDPKGIGPFILAGLELAKE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	53	393	2.6e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.53e-107	33	394	3	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.38e-96	57	394	34	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE19946.1	1.96e-154	1	393	1	394
ASB48052.1	4.48e-146	1	392	1	391
AUD01333.1	7.83e-141	1	391	1	394
QHL86730.1	2.92e-140	1	391	1	401
AKQ47488.1	8.05e-140	7	391	9	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.94e-109	57	391	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.77e-81	54	392	36	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.24e-80	54	392	26	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	1.52e-19	57	341	47	329	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	5.85e-14	145	391	183	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.25e-80	54	392	36	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.34e-38	168	391	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.34e-38	168	391	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003497_01283.