CAZyme Information: MGYG000003498_00008

Basic Information

• Species: UBA7173 sp900768685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900768685
• CAZyme ID: MGYG000003498_00008
• CAZy Family: GT4
• CAZyme Description: Alpha-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000003498_2|CGC1	40205.67	8.1733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003498	2015725	MAG	Fiji	Oceania

• Gene Location: Start: 2020; End: 3105 Strand: -

Full Sequence      

MKIAVTGTRGIPNIMGGVETHCEHLFPRIAALGYDVSIIRRSNYATDTLSEWNGVKLVDI
PSPHKKAFEAIVHTARSIFAAKRMGADVVHIHAVGPALVTPLARMLGMKVVFTHHGPDYD
RDKWGKAAKFMLRLGERLGCKFANRVIVISDVIKNIIAQKYGRTEGVHLIYNGVPAPDKC
NFPEYFESLGIQEGKYVLGMSRFVPEKNLHHLIEAFDKVKPEDVKLVIAGDSDFEDEYST
KLKELAKQKGVILTGFIKGKKLHSLITNSRCFVLPSSHEGLPIALLEAMSYNLPVIVSDI
PANMEVGLDKDSYFHVGDVGELASKIKKICDADFCRVDYDMSKYDWDCIARQVGEVYKNL
S

Enzyme Prediction     

No EC number prediction in MGYG000003498_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	192	330	7.1e-31	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.46e-58	2	358	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.55e-43	1	360	1	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.66e-42	2	355	1	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03819	GT4_WavL-like	2.68e-41	14	338	9	327	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03808	GT4_CapM-like	2.47e-40	11	329	5	326	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT84505.1	1.07e-191	1	360	1	360
QJR77151.1	3.08e-191	1	360	1	360
AII63545.1	3.08e-191	1	360	1	360
QEW36414.1	3.08e-191	1	360	1	360
ALK85623.1	3.71e-190	1	360	2	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N7Z_A	8.64e-07	142	360	133	344	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	8.67e-07	142	360	134	345	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	8.69e-07	142	360	135	346	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26402	1.58e-13	117	354	116	346	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
Q8CWR6	7.58e-13	1	301	1	316	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1
P71055	4.80e-12	16	308	18	319	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
A6ZW78	1.42e-11	15	361	16	379	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=SPT14 PE=3 SV=1
B5VSZ6	1.90e-11	15	361	16	379	Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=SPT14 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003498_00008.