CAZyme Information: MGYG000003498_00328

Basic Information

• Species: UBA7173 sp900768685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900768685
• CAZyme ID: MGYG000003498_00328
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000003498_12|CGC1	41611.37	9.2835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003498	2015725	MAG	Fiji	Oceania

• Gene Location: Start: 264; End: 1394 Strand: -

Full Sequence      

MRYFLIAGEASGDLHASELIRAIKSYDPEASFRFLGGDKMAEAAGVQPVVHYKKMAYMGF
VDVLLHLRSVLGNLDAAKKSLKDFSPDALVLIDYPSFNLRVAKYAVTLGIPVYYYISPKV
WAWKEHRVKEIKKLVKQMFCILPFEVDFYKTRHNYDVTYVGNPSLNEVDRKLAEIVSKED
FYKSNALSSKPLIALVPGSRISEIKTNLPYMLGAAKNFESDYQPVIAAAPGVDEEIYDRL
APGVTRLSGQTFELMRYASAALVTSGTATLEAALLGTPQVVAYRAVGSKLVYNFFKKILK
VQFVSLPNLICGREIVKELLLHLCTVDSLSAALADILPGGSHHSALLADYAHLRTLLGTN
NAPQTAAQIISRQLQK

Enzyme Prediction     

No EC number prediction in MGYG000003498_00328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	4.8e-108	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.35e-109	1	376	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.19e-107	1	370	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.54e-81	4	370	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.06e-74	5	368	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.35e-50	1	329	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	7.90e-145	1	370	1	370
ASB37800.1	7.90e-145	1	370	1	370
ANU64105.1	7.90e-145	1	370	1	370
QCD36425.1	2.17e-143	1	370	1	370
QUB68537.1	1.27e-123	1	374	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.44e-42	5	370	11	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.64e-41	5	370	11	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.00e-68	2	370	6	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	6.76e-66	2	376	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	1.62e-63	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	1.36e-62	5	339	14	352	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q39T49	7.11e-62	2	376	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003498_00328.