CAZyme Information: MGYG000003498_00330

Basic Information

• Species: UBA7173 sp900768685
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900768685
• CAZyme ID: MGYG000003498_00330
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000003498_12|CGC1	83297.15	5.4152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003498	2015725	MAG	Fiji	Oceania

• Gene Location: Start: 2392; End: 4644 Strand: -

Full Sequence      

MKTFHFLFAAALCASANVSAQDIVATDAYRWTGDSIIQGEYKAFAPDAFHLVSNYSARPH
FYMPIEKQWTLKNDISSYPQLTTPNTLHAAVYNMALDEMVNAVEPDTTLRTGKEWAGVWT
RDVSYSIILSMAYLQPEASKISLMKKVNPAGKIIQDTGSGGAWPVSSDREIWAVAAYELY
KVTGDHAWLEYIYPIICRSIDDDLATVHTERGLVKGETSFIDWREQSHPKWMQCVDIYGT
EALGTNVVHATALDVAAKTATALGDKKGAEKYAKLHDELVKNINDKLWLADKGYYAMYYY
GRNYPILNPRAETLGESLAILYNVASADRAKTITENNPITPFGPAIFYPQISDMPSYHNN
ALWPFVAAYWGLANAKAGNENGVMQAIGSIFRPAALFCTNKENFNLDNGDIYTELNSSNM
LWCLSGNLAMTYRILFGIHYEDGKLDFKPFVPKALAGTRTLKGYPYRGAKLNITVEGSGD
EIKSFTVNGKEQAPEISAKNLKGEYDIRIVMADNDIAPLKVNNVPNEKAPWTPIAWLENG
ELRWNPIEYIGHYVVLRNGERIATTRQTKFDITQDGEYQVIGVATNGTESFASEPRNTVK
PIAIQMPGESTSLDSPEVSYLPKEPLEGFYGNGFVQIDHNTAAIELNVNIEKAGNYSVTF
RYANGNGPVNTENKCAIRTLAVDGNRAGVIVMPTRGVANWNDWGITNPLHVKLSEGQHKI
TLYFDLGNENMNLATNHAILDCAFITFLAD

Enzyme Prediction     

No EC number prediction in MGYG000003498_00330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM35	627	731	3.7e-16	0.8067226890756303

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	2.53e-16	628	728	22	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3459	COG3459	1.72e-11	85	514	570	1055	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	7.77e-11	628	722	21	108	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04086	CBM35_mannanase-like	3.33e-09	628	723	21	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
COG3408	GDB1	3.65e-09	115	474	281	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	7.97e-230	66	741	212	886
AKQ46615.1	3.09e-229	69	746	228	903
QNK61875.1	2.25e-228	69	741	216	884
QTE38578.1	5.10e-227	69	741	214	882
BAU55184.1	6.76e-226	58	741	221	900

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000308	0.998761	0.000401	0.000193	0.000178	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003498_00330.