CAZyme Information: MGYG000003500_00315

Basic Information

• Species: Butyrivibrio_A sp900768755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp900768755
• CAZyme ID: MGYG000003500_00315
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000003500_10|CGC1	77976.21	4.7834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003500	2005892	MAG	Fiji	Oceania

• Gene Location: Start: 29565; End: 31586 Strand: +

Full Sequence      

MKFVDDNGALVFYHGGEMTRIEAWGKDSFRVRSTMLGKYSGNDWALTEPADKTGGKVVIE
KEDHWVGDGTIDKREIATITNGRVKAVVNFCGIITFYRDGEKILREYYRMYDGTLSKESR
CLKVINREWKGVIGGSQYSLNLKFESNDGEKIFGMGQYQQPYMDLKGCTLELAQRNSQIS
VPFSVSSLGYGFLWNNPAVGQVTFGKNYTEWVAKSTKEMDYWITVADAPKDILANYTDVT
GHADMFPEDLMGLWQCKLRYRTQDEVLTVARQYQKEGIKIDQIVIDFFHWTVQGDWKFDK
TYWPDPKAMVDELHSMGIKVIVSVWPSVDRKSENFYPMREQGLLIKTERGAEQTYDYQGD
CVEIDPFNPATRKYVWEVCKKNYYDYGIDAFWLDNSEPDYGVYDFENYRYCDGPALEISN
MYPQMYSRVFYDEMSKLGKPVVNLLRCAWAGSQKYGNVVWSGDVPSTFEAFYDQLQCGLN
MGLAGIPWWTTDIGGFMTDDVNDPDFRQLLIRWYQFAVYSAVLRMHGDRGPYNIPPLDDR
DWGGGYLHTGQPNELWSYGEDNYAIMKKYYDIRISMHDYIKSLYEEAHVNGSPLIRTMFY
EFPKDAKCWELTDQYMFGDKYLVAPIFRLNQFEREVYLPEGSWQLTSTGETMQGGCTVKV
AAPIDYMPVFVRM

Enzyme Prediction     

No EC number prediction in MGYG000003500_00315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	221	672	3.9e-132	0.9859484777517564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	2.91e-153	77	672	72	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	1.40e-152	241	573	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	2.67e-129	227	672	6	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10658	PRK10658	6.39e-58	48	672	83	663	putative alpha-glucosidase; Provisional
cd06592	GH31_NET37	2.22e-55	259	643	13	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98925.1	0.0	1	672	1	672
ACZ98613.1	0.0	1	673	1	674
AHF24694.1	0.0	1	673	9	682
QTE68763.1	0.0	1	670	1	663
AIF26052.1	0.0	1	673	1	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	7.98e-104	3	670	3	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
5JOU_A	2.17e-75	211	672	367	839	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	5.56e-74	133	672	168	860	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	7.04e-73	213	672	397	869	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	8.00e-58	180	672	195	683	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01336	3.20e-188	2	531	3	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
Q9P999	7.91e-104	136	672	98	617	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A2QTU5	6.75e-103	3	670	21	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
A7LXT0	1.17e-74	211	672	366	838	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q5AW25	3.55e-55	149	672	177	691	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003500_00315.