CAZyme Information: MGYG000003500_00868

Basic Information

• Species: Butyrivibrio_A sp900768755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp900768755
• CAZyme ID: MGYG000003500_00868
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000003500_25|CGC1	57006.83	4.6969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003500	2005892	MAG	Fiji	Oceania

• Gene Location: Start: 24406; End: 25899 Strand: -

Full Sequence      

MTKESYEKNRDEYLARIDEVIAKGPYKDTWESLTDMEIPEWFCHDKFGIFIHWGLFSVPA
FNNEWYSRNMYVQGSEEYNHHIETYGPHKDFGYKDFIPMFTAPEFDADEWVSLFKEAGAR
YIVPVAEHHDGFQMYDSVFSDYTAVNMGPKRDVLGEIKKAAEDNGLTFCTSSHRAEHLWF
MGPGKEFDSDIKEPLNIGDFYWPSLKEQPNQEDIFATPYPTEEFLTDWLIRSCELIDKYQ
PKILYFDWWIQHEGYKDTLKKITAYYYNRGLEWGYKTAVCYKHEAMAFGSGIVDVERGKF
ADVKPYHWQTDTAIAHNSWCYTTSLDYKTSYQIICYLADVVSKNGNLLLNVGPKGDGSIP
DKDKEILKDIGRWLSINGEAIYDSKTWRYAAEGPTIEAEGKFSEGNSGDYTSEDFRFTAG
HGCIYAICMRFPADGIVRIKSLARGGANSSAFQGIICGVDVLGCDVPVTYRHEDDGLLVE
ATGFSSDFPVVIKVHTY

Enzyme Prediction     

EC	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	17	383	1.3e-110	0.9450867052023122

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	4.19e-136	21	442	2	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	6.20e-123	21	379	1	333	Alpha-L-fucosidase.
COG3669	AfuC	7.84e-105	52	444	1	381	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	0.001	106	166	1	60	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam16757	Fucosidase_C	0.003	409	480	3	70	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF45277.1	1.67e-248	10	496	3	491
QNU68446.1	2.10e-236	13	495	4	486
ATF71355.1	2.53e-230	17	494	7	485
QOG31912.1	5.09e-230	17	494	7	485
QGN30651.1	7.22e-230	17	494	7	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	1.19e-131	13	493	27	511	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	6.71e-131	13	493	27	511	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	2.21e-82	22	463	3	452	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
1ODU_A	9.69e-65	20	442	2	401	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
2ZWY_A	1.12e-64	20	442	2	401	alpha-L-fucosidase[Thermotoga maritima],2ZWY_B alpha-L-fucosidase [Thermotoga maritima],2ZWZ_A alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZWZ_B alpha-L-fucosidase complexed with inhibitor, Core1 [Thermotoga maritima],2ZX5_A alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX5_B alpha-L-fucosidase complexed with inhibitor, F10 [Thermotoga maritima],2ZX6_A alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX6_B alpha-L-fucosidase complexed with inhibitor, F10-1C [Thermotoga maritima],2ZX7_A alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX7_B alpha-L-fucosidase complexed with inhibitor, F10-2C [Thermotoga maritima],2ZX8_A alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX8_B alpha-L-fucosidase complexed with inhibitor, F10-2C-O [Thermotoga maritima],2ZX9_A alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZX9_B alpha-L-fucosidase complexed with inhibitor, B4 [Thermotoga maritima],2ZXA_A alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXA_B alpha-L-fucosidase complexed with inhibitor, FNJ-acetyl [Thermotoga maritima],2ZXB_A alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXB_B alpha-L-fucosidase complexed with inhibitor, ph-6FNJ [Thermotoga maritima],2ZXD_A alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima],2ZXD_B alpha-L-fucosidase complexed with inhibitor, iso-6FNJ [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48300	3.15e-52	26	479	37	441	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
Q9BTY2	1.23e-51	26	480	34	444	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q99KR8	5.68e-51	26	435	28	400	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q5RFI5	8.59e-51	26	435	32	404	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
Q6AYS4	1.48e-49	26	480	26	436	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003500_00868.