CAZyme Information: MGYG000003500_01535

Basic Information

• Species: Butyrivibrio_A sp900768755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp900768755
• CAZyme ID: MGYG000003500_01535
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000003500_32|CGC2	41295.2	4.5368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003500	2005892	MAG	Fiji	Oceania

• Gene Location: Start: 58622; End: 59719 Strand: +

Full Sequence      

MRMKKILALILATVMAGSIVTGCFGQKTSVTEPESTTTISGGDESIGGGTTSGNTEENTT
PDYTQSDRVVEKGMLSNPNADKKTQKIYEYIWDNFGTNIITCQQESTWKGTPDYEMNYIE
ETTGKLPAMRGLDFMNNDFNGVVSRAKAWAEKGGLVTICWHTGISSSGYQESLDDRADFS
KLFTPGTDEYNTLMASWDKAAKALLRLQDAGVTVFWRPFHEFDGRWFWWGKAGANKFVQL
WQLMYNKFTYEYGLNNLIWVLGYTGNVRDGWYPGDEYCDIIGSDSYDNNTNVSGYNKLLK
VSENKPLCFHECGNVPLVEDFENDKAMWSWFMIWHTDHLMANDKDTLSAVYNSDKAITLD
KLPEF

Enzyme Prediction     

No EC number prediction in MGYG000003500_01535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	76	360	2.2e-85	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.01e-42	77	360	2	310	Glycosyl hydrolase family 26.
COG4124	ManB2	6.42e-15	187	313	157	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	1.14e-105	75	364	167	461
BCN30282.1	1.44e-103	70	365	1	299
AWB26443.1	8.78e-71	75	364	48	338
ATC26721.1	7.64e-70	75	362	1	294
QQQ74226.1	2.40e-67	77	363	175	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	4.46e-50	46	361	16	338	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3ZM8_A	6.24e-49	75	362	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	1.25e-46	77	362	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	5.07e-42	78	363	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	5.90e-39	107	362	31	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.43e-48	75	362	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.02e-47	74	365	145	460	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	4.47e-36	77	362	30	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	5.97e-31	75	360	24	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	2.15e-30	58	365	139	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003500_01535.