CAZyme Information: MGYG000003506_00469

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196
• CAZyme ID: MGYG000003506_00469
• CAZy Family: GH57
• CAZyme Description: 1,4-alpha-glucan branching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		30351.45	4.7093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003506	1361363	MAG	Fiji	Oceania

• Gene Location: Start: 313; End: 1089 Strand: -

Full Sequence      

MHYWRITSPTTDLGDKMLYDPVLAMNKINENSDHYTTLIYHLLNDYKLAHDGKEGLVMVS
FDTELFGHWWFEGVEFIKQVIKKFNDYLPEVERLTAGEYVTKYPPKEAIQIPESSWGQGG
HFYVWMNHLTEWMWPIIHSCEKRINAIVDAHSEIPEDKLMLRALNQLARENLLLQSSDWP
FLITTWQAKDYATDRFNEHVDRFSLIADMIESGNIDEAKLKEIEDIDNCFPEIDYRVYQS
IAEGTIPQQEKKLAPLYK

Enzyme Prediction     

EC	2.4.1.18	3.2.1.1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1543	COG1543	7.09e-64	3	240	273	503	Predicted glycosyl hydrolase, contains GH57 and DUF1957 domains [Carbohydrate transport and metabolism].
pfam09210	DUF1957	3.51e-41	140	238	2	98	Domain of unknown function (DUF1957). This domain is found in a set of hypothetical bacterial proteins. Its exact function has not, as yet, been defined.
cd10816	GH57N_BE_TK1436_like	6.38e-41	1	127	299	423	N-terminal catalytic domain of Gh57 branching enzyme TK 1436 and similar proteins. The subfamily is represented by a novel branching-enzyme TK1436 of hyperthermophilic archaeon Thermococcus kodakaraensis KOD1. Branching enzymes (BEs, EC 2.4.1.18) play a key role in synthesis of alpha-glucans and they generally are classified into glycoside hydrolase family 13 (GH13). However, TK1436 belongs to the GH57 family. It functions as a monomer and possesses BE activity. TK1436 is composed of a distorted N-terminal (beta/alpha)7-barrel domain and a C-terminal five alpha-helical domain, both of which participate in the formation of the active-site cleft.
cd10792	GH57N_AmyC_like	1.41e-28	3	127	293	412	N-terminal catalytic domain of alpha-amylase ( AmyC ) and similar proteins. Alpha-amylases (alpha-1,4-glucan-4-glucanohydrolases, EC 3.2.1.1) play essential roles in alpha-glucan metabolism by catalyzing the hydrolysis of polysaccharides such as amylose starch, and beta-limit dextrin. This subfamily is represented by a novel alpha-amylase (AmyC) encoded by hyperthermophilic organism Thermotoga maritime ORF tm1438, and its prokaryotic homologs. AmyC functions as a homotetramer and shows thermostable amylolytic activity. It is strongly inhibited by acarbose. AmyC is composed of a N-terminal catalytic domain, containing a distorted TIM-barrel structure with a characteristic (beta/alpha)7 fold motif, and two additional less conserved domains. There are other two canonical alpha-amylases encoded from T. maritime that lack the sequence similarity to AmyC, and belong to a different superfamily.
cd01022	GH57N_like	5.08e-11	19	127	209	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39099.1	4.89e-169	1	258	316	572
ABX07093.1	1.59e-73	1	238	406	641
QPC81774.1	4.41e-61	1	236	341	572
AHF79441.1	2.66e-55	3	248	300	546
ACS90169.1	5.12e-55	3	256	299	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3N8T_A	3.02e-50	3	230	296	523	ChainA, alpha-amylase, GH57 family [Thermococcus kodakarensis],3N92_A Chain A, alpha-amylase, GH57 family [Thermococcus kodakarensis],3N98_A Chain A, alpha-amylase, GH57 family [Thermococcus kodakarensis]
5WU7_A	3.37e-49	3	247	298	542	Crystalstructure of GH57-type branching enzyme from hyperthermophilic archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5WU7_B Crystal structure of GH57-type branching enzyme from hyperthermophilic archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
2B5D_X	1.49e-40	3	237	291	522	Crystalstructure of the novel alpha-amylase AmyC from Thermotoga maritima [Thermotoga maritima MSB8]
3P0B_A	1.70e-39	1	238	318	535	Thermusthermophilus family GH57 branching enzyme: crystal structure, mechanism of action and products formed [Thermus thermophilus]
1UFA_A	4.96e-39	1	238	298	515	Crystalstructure of TT1467 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5JDJ7	6.93e-49	3	230	296	523	1,4-alpha-glucan branching enzyme TK1436 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1436 PE=1 SV=1
Q5SH28	7.33e-39	1	238	298	515	1,4-alpha-glucan branching enzyme TTHA1902 OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1902 PE=1 SV=1
P9WQ26	1.68e-18	5	219	288	503	Probable 1,4-alpha-glucan branching enzyme MT3115 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3115 PE=3 SV=1
P9WQ27	1.68e-18	5	219	288	503	Probable 1,4-alpha-glucan branching enzyme Rv3031 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3031 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003506_00469.