CAZyme Information: MGYG000003512_00050

Basic Information

• Species: UBA11524 sp900769075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp900769075
• CAZyme ID: MGYG000003512_00050
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000003512_3|CGC1	39913.27	4.9322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003512	2777574	MAG	Fiji	Oceania

• Gene Location: Start: 21234; End: 22286 Strand: +

Full Sequence      

MNYNEIAQRVMSRLVATRDGGAGNPEDHMNLSTWEWPQGVAMYAMMKVYQSTRNESDLQD
IKAWYAAHIRRGLPVRNINTTAPMLAMTMLYEETKDETYRPLIEDWANWVMTGLPRTEEG
GFQHITTHDVNEEQIWDDTLFMTVLFLYRAGVALSRRDWREEAKYQFLLHIKYLHSQKTG
LWYHGFCFIGRHHFGEAYWARGNSWFTCGAVDFVEWLIQAGEAEDCTTRFILTAWKEQCL
KLVELQDKETGLWHTLLDAEDSYVETSASAAIAYGLLKGVRLGLLDGACKEAAERALQGV
IAQVGEDGIVGGVSYGTPMGHTKDFYRTIPIEATAYGQGLTFLMLTEVME

Enzyme Prediction     

No EC number prediction in MGYG000003512_00050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	349	5.1e-97	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.05e-92	34	349	34	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.18e-86	34	348	27	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00968.1	2.22e-115	2	347	3	341
AGI39070.1	6.31e-115	2	347	3	341
ANW98431.1	6.31e-115	2	347	3	341
AGC68039.1	6.31e-115	2	347	3	341
AGC68046.1	1.17e-109	5	349	9	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	9.98e-89	6	347	29	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.09e-85	23	347	55	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.01e-83	34	347	47	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	1.14e-21	34	347	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.88e-21	34	347	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	4.04e-47	34	350	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	6.26e-21	34	347	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.28e-06	142	331	1	210	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.28e-06	142	331	1	210	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003512_00050.