CAZyme Information: MGYG000003512_02431

Basic Information

• Species: UBA11524 sp900769075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp900769075
• CAZyme ID: MGYG000003512_02431
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000003512_109|CGC1	35546.12	6.2771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003512	2777574	MAG	Fiji	Oceania

• Gene Location: Start: 14189; End: 15127 Strand: +

Full Sequence      

MRQLSNPHATPEAVRLYEYLCSLKGKACLTGQMESGWRGTFEGEMNHLQEQTGCLPAIRG
LDFIANDFDGVARRAIDWHARGGIVTVCWHTGPDFASSYRQSQEDELDWANALTPGTAAH
EALLRGMDRAVPSLRKLLEHRIPVLWRPFHEFDGKWFWWGRGGADGFIRLWRLMYDRYTR
VHGLNNLIWVLGYSDAPGELAPWYPGDDVVDILGGDSYKGGAQGDLYRKCAAIAPAGMPI
CYHENGEIPTRAQMAQENAPWVWFMTWHTRWITSAEYNPPDRLREVFQDDFFVKLHQVPE
DVAGKGRTPPDR

Enzyme Prediction     

No EC number prediction in MGYG000003512_02431.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	294	5.9e-84	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.36e-43	6	291	2	305	Glycosyl hydrolase family 26.
COG4124	ManB2	1.14e-13	142	229	180	269	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	1.08e-104	2	300	4	298
ADU20874.1	8.72e-101	4	311	167	476
AOW25662.1	2.93e-83	9	308	6	300
AJP70762.1	2.34e-81	4	302	22	322
ATC26721.1	7.85e-81	4	298	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	9.80e-60	6	298	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	4.12e-47	4	298	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	1.49e-45	7	299	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	3.13e-44	6	298	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	9.16e-42	2	279	43	326	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.77e-52	2	298	172	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	5.12e-44	4	299	156	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	7.28e-44	4	299	158	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P49425	2.28e-43	3	300	145	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	1.96e-41	4	299	157	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003512_02431.