CAZyme Information: MGYG000003513_00255

Basic Information

• Species: Prevotella sp900769055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769055
• CAZyme ID: MGYG000003513_00255
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000003513_37|CGC1	97149.92	6.5871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003513	2720584	MAG	Fiji	Oceania

• Gene Location: Start: 7785; End: 10358 Strand: +

Full Sequence      

MRIISTTLSRLSHGLMSWFPVRMPHVCLAAAFLFLMMPLSAAERFISFGRGDIHLNAGGR
TCVAYSSGDCRGVSRAVQSLASDIKSVCGADVTLSPDDASSATIVIGTIGHSPLIDRMAR
EGVKPLQMLSGKREQYVITSVAGKIVIAGSDRRGTIYGIYELSRQMGVSPWYYWMDVPTD
HHDNVYMRAGVYTDGEPVVRYRGIFLNDEAPCLTSWVKNTFGTEYGGHEFYERVFELILR
LKGNMLWPAMWGWAFYADDPENRRLAYEMGVVIGTSHHEPMARNHQEWARHRKEYGAWNY
NTNRETIKRFFREGIERMKGTDDIVTIGMRGDGDEAMSAEADTKLLMEIVADQRKIIKDV
TRRPAKETPQVWALYKEVLDYYDKGMRVPDDVIMLLCDDNWGNVRRVPTAKERKHKGGWG
LYYHVDYVGAPRNTKWLNVTPIQNMWEQLTLAADYGIESLWILNVGDLKPMEYPITLFLD
MAWNPKRYTIDNILGHTHDFCREAFGESQAEEAARILNLLCKYNGRVTAEMMDKDTYNAE
TGEWQRVVTEYTELERDALNQFVTLPEPMRDAYRQLILFPVQAMGNLCRMYQAQAMNHLL
AAAGNPDANCWAEKVRECFKRDSLLCDYYNTKMAGGKWNGMMTQKHIGYTTWNDNFPCDR
MPEVKTVTTTGGGNNIFTAKDGVAVMEAPHYYAATPSATAAWTELPYMGRTLGGMALMPY
TEPVGGAWIEYRFETAEGDVKADSVDVRIVVKSTLDFLNKGGHVYDVSLDGSAPVSVNFN
SMLNEKPENIYSIYYPTIARRVVESVVRLPIKRGAATHSIKIIPRDPGIVFEKVVVDMGG
YVSSYLFMDESPRRQEK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	60	834	6.1e-270	0.9827833572453372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	195	531	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.30e-37	677	850	2	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	5.59e-06	56	162	10	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
pfam02838	Glyco_hydro_20b	0.002	46	166	11	107	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85271.1	0.0	35	851	15	828
CCG34758.1	0.0	55	853	3	800
QNT66545.1	0.0	28	840	11	844
QCD34650.1	0.0	59	851	43	842
AGB29053.1	0.0	39	852	26	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	41	856	30	854	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	55	855	20	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	55	855	19	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.45e-177	69	819	31	778	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	6.33e-119	72	654	31	647	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.323782	0.672712	0.002661	0.000335	0.000207	0.000296

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003513_00255.