CAZyme Information: MGYG000003513_00574

Basic Information

• Species: Prevotella sp900769055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769055
• CAZyme ID: MGYG000003513_00574
• CAZy Family: CBM62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1049		115832.26	4.7418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003513	2720584	MAG	Fiji	Oceania

• Gene Location: Start: 2325; End: 5474 Strand: -

Full Sequence      

MDISIPKHLPSLSIIGPPQRGAGGLLLIFFLFTTLFASAQSFQHPALVNTRADLDFIKQK
VEAKEQPWYGAWQNMCNEWKANSGYSTPGSSDGDIGGSNGNRQRASRDAQAAYYNMLRWY
VTGDEAHAKCAVNILNKWTETITCVASDQLFQLPIISMVEAAELVSLYDGWEEKDREAFK
TMCLEKWYPGLKNFLSHCGSWPGWDGPANLGCMVVGVFCDRRDIFDEAVRYYKDGAEGTG
YGGGRLTNMIFNNKGQSIEMGRDMPHAEIGLDAAAELCEVAWNNGVDLWSLEDNLLLKGF
EYLYRYNLEHLCDWTPYNDCADRYFYSVSLNSPYRITGFPGSEATFNHYVLRKGMDAPYI
TNAIRLRGLQNYGWDACNYTMLTYMDEGIQNYVTALDAPATPMAVEATPLIGGIRLKWQR
PDWTTVSGSIIERREAGTEEWTKAYEYTNNTSTEYVDTPLTGGKTYEYRIALKNNSAKGE
YCNVVKATAVDGSAVMPDSWKLTDIGSVESEGDALYYEGNGHNFSVTSRSYEMKANGETD
NFTFLYRKLTGSFTITGRIYAYDRCDGRADMFGLMIRESLAGGARMAAVCQNNYDARYAY
MLARKTANSATTSWPGDTHTFVGSWFKLVRKGTTFTAYQCFDGINWQEVYTTTISGFAST
CYVGMFASRGWNGATGETRVFFDNISVASTSGNDGCPAPTGFMAADVNATSVQLAWDGND
AVSSYSVKCCLPGSDTFYTIADALTDNTFTHNGLTPETTYRYVVIAQNVAGQTSSDTISV
TTSSLAAPEMPQALKATPNITYAFLDWTAQSDIEEYDISRSLSSDYGFEVIATVPSGNLH
QGAAGRVGWLDLTTSLNSTYYYKVRARNALGESDYTEPVMLTVSLQQKLAGTTIEGAAQG
TMLTIDLGEGNECVVTQVRYKPTSAHIDGFVGSVFYGSNQADFAESSILHNVTTRPESSS
VWTRQSVFDTTPYRYLRFVSPTEGITSSEIAFYGLTHEASGIELNETETDTTTRWYTVSG
VEVSKPGKKGIYIKQPSCPPVGGTKHLIK

Enzyme Prediction     

No EC number prediction in MGYG000003513_00574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM62	897	994	4e-17	0.7251908396946565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	2.30e-16	101	306	50	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd00063	FN3	5.93e-10	697	782	2	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
pfam00041	fn3	3.88e-07	697	772	1	81	Fibronectin type III domain.
smart00060	FN3	2.06e-06	697	772	2	82	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
cd00063	FN3	2.37e-05	399	488	1	92	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP82778.1	2.50e-111	25	1016	13	989
AXP82777.1	5.07e-109	26	694	22	683
QMW04693.1	2.04e-52	26	402	23	409
BAV06996.1	3.79e-48	37	384	15	378
QDV63998.1	6.29e-43	30	367	14	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G56_A	3.27e-13	785	994	614	839	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
2YB7_A	3.07e-11	898	994	42	138	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YB7_B Chain B, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFU_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFZ_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YG0_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q23551	4.44e-08	398	489	5034	5126	Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=3
P50899	4.09e-07	606	904	716	1027	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
P26225	1.20e-06	703	882	756	936	Endoglucanase B OS=Cellulomonas fimi OX=1708 GN=cenB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.147787	0.850438	0.001045	0.000289	0.000210	0.000215

TMHMM  Annotations     

start	end
21	43