CAZyme Information: MGYG000003513_00891

Basic Information

• Species: Prevotella sp900769055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769055
• CAZyme ID: MGYG000003513_00891
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1250	MGYG000003513_127|CGC1	141146.48	5.1661

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003513	2720584	MAG	Fiji	Oceania

• Gene Location: Start: 23662; End: 27414 Strand: -

Full Sequence      

MREKIDCFLPCADIADLAETIGDLTASKTVQHIHLLTGNISKITNTPQGVELLETRQPLS
TDTILEIAQRTDAEYVLISTKPTPVRLVQHSLERFLRVAADANAAMVYSDHYSVVEGTVV
RHPVIDYQKGSVRDDFDFGQLVLVNASLLHEYAATPPAHKYAHAGLYDLRLFLSRKGEIF
HINEFLYTEEELDNRKSGEKQFDYVNPRNRAVQEEMEQAVTHHLAETGALVDTYFCKVPD
FDEQDFEYEASVVIPVYNRSRTIADAVGSALSQKTSFRYNVIVVDNHSTDGTTEILRQLS
ADDRLIHIIPTRTDLCIGGCWNTALEHAKCGRFAVQLDSDDLYSSEHTLQRIVDAFYRQN
AAMVIGSYRMCDFSLNTLPPGLIDHREWTDDNGCNNALRINGLGAPRAFFTPLARQISFP
NTSYGEDYAMGLAFSRRYRIGRIYDELYLCRRWEGNSDAALSIEKVNANNTYKDKLRTLE
ISARQQLSQGKADIAADNKLQRFFNRQLEVWEETNQNYQQLCHVRKKSFGDIELQHNPAR
IVSTGASIDKASIDKRPCFLCSKNRDDRQMAKVLDCGLELLVNPFPILPMHFTLPTCKHQ
PQDVRLLYGSIHSLLEHFPEIMVFYNGPRCGASAPDHAHLQAGTSGLLPLQACWQRLCRS
LETVCEEDDGAQLSYITEYTVPAFVIQSRTQQAGERLFNTLLNAMPTADGDTEPMMNIVA
WRLDDSYVSIVFPRRKHRPDCYFAEGKQKVLASPGALDMAGLLILPRSEDFDNMTQQTAE
DILKEVAVTKQQAKEIADRIQAGQETATEVPMLESQPQVCVGLVNTEKISFTLNKPYLAK
GEELTGPQEVTFAEGGLLWNGNSYRELLFSPVDKAASFSIEDVTIGIDFHWERTQTLTYR
GALRLVVEEDKICAINELPVESYLESVISSEMKATSSLELLKAHAVISRSWLLAQMEKRR
KQQESGNNFFSFVKGEDMLIKWYDREDHTIFDVCADDHCQRYQGITMETSQHVAKAVRQT
RGQVLTSDGTICDARFSKCCGGATEEFQFCWEDTPKSYLKAIADSDTAGALPDLTIEENA
EKWIRTSPDAFCNTTDRQVLAQVLNDYDQETADFYRWTVEYTNREIRDIITEKLKTDLGD
IIDLIPVERGKSGRISKLRIVGTQRTFTIGKELEIRRILSKTHLYSSAFIIDKLDFVDGV
PSTIRLTGAGWGHGVGLCQIGAAVMGEKGFSYDEILLHYYSDAQITTLYK

Enzyme Prediction     

No EC number prediction in MGYG000003513_00891.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	251	377	7.2e-24	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	4.68e-100	608	794	2	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	1.03e-47	914	1246	2	266	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	5.28e-41	854	1248	89	393	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	5.78e-34	914	1245	68	335	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	1.35e-29	908	1026	1	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84357.1	0.0	1	1250	1	1253
QNT65264.1	0.0	1	1250	1	1260
ADE82754.1	0.0	1	1249	1	1223
QVJ80566.1	0.0	1	1249	1	1223
QYR11045.1	0.0	3	1250	2	1246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RWR_A	2.77e-10	902	1247	50	319	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5I1T_A	6.52e-10	917	1249	63	330	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	7.70e-10	917	1249	87	354	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QYX7	8.48e-11	886	1245	72	351	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P07372	3.95e-10	914	1246	71	330	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1
O32268	1.27e-08	251	370	9	125	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q02113	1.64e-08	924	1247	422	704	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
P13251	6.85e-08	914	1246	72	331	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003513_00891.