CAZyme Information: MGYG000003513_01239

Basic Information

• Species: Prevotella sp900769055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769055
• CAZyme ID: MGYG000003513_01239
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000003513_173|CGC1	62615.59	9.9086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003513	2720584	MAG	Fiji	Oceania

• Gene Location: Start: 11195; End: 12844 Strand: +

Full Sequence      

MVEEAHYYVLRSASGSDSVYTYIYNGGDTVIAESDNARFMSNITRRRSASWVNWLWLPSC
FGTLASRTDTTEERNSCLPPLQAHQARLLLDSRCSAIRNKAAGMQKQLSEIDYYMRTHKV
HDEGFDVVARRRETVLHSIDSLTRMAASIERIVSSGQFSVTLTDRYTVVMDSIRMEARKI
SSWRDGFAMFRTANGSTPRNVRPVYLYADGLLSSLRPTAALRLPSDTIVVRSDVGGGKTD
GYMSVLYPDGSYYEGQYADTLGGMLRHGFGVDFRAEKVRVGRWEYDRYRGEQPLYTAAHI
YGIDISRYQHEPSSQTARKGRRRRKVTYPIMWNQLRITSLGSMSRKRVDGDVDYPISFIY
IKSTEGRSLTNRYFRADYAAARKHGYRVGAYHFFSTRTTARQQADHFVKNSKYQKGDLPP
ALDVEPSTAQIAQMGGSKVLLKAVRSWLEDVERRLGVRPILYVSQSFVNKHLTADNPDGD
YLRQNYQVWIARYGEYKPDVHLAIWQLSPDGRVRGIRGLVDINVFNGFDEAFREFSSISA
HSLPQPSPR

Enzyme Prediction     

No EC number prediction in MGYG000003513_01239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	355	516	3.7e-41	0.8926553672316384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	2.87e-45	301	527	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	5.55e-43	300	527	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.92e-41	301	525	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.43e-32	349	516	7	180	Glycosyl hydrolases family 25.
COG3757	Acm	9.67e-31	285	527	50	255	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK97053.1	4.17e-112	2	535	45	570
ASE18093.1	4.17e-112	2	535	45	570
BBA29745.1	7.20e-110	2	535	45	570
QUB57104.1	2.23e-108	2	535	45	570
QUB59159.1	2.23e-108	2	535	45	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.37e-19	350	535	26	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	2.56e-26	300	535	67	264	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	4.77e-26	300	535	67	264	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	1.21e-25	300	535	67	264	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
P34020	3.62e-09	350	526	11	181	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996579	0.002646	0.000584	0.000066	0.000022	0.000118

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003513_01239.