CAZyme Information: MGYG000003514_00756

Basic Information

• Species: Fibrobacter_A intestinalis
• Lineage: Bacteria; Fibrobacterota; Fibrobacteria; Fibrobacterales; Fibrobacteraceae; Fibrobacter_A; Fibrobacter_A intestinalis
• CAZyme ID: MGYG000003514_00756
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		34744.47	10.1428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003514	2933446	MAG	Fiji	Oceania

• Gene Location: Start: 58474; End: 59379 Strand: -

Full Sequence      

MRKFRVKQSVLDFWNRIPPQKRKAIGIVGCVFKWIYRILNRIVRLVLLSLTLYAIAFTLV
ASFLLYRAFLYGYEIYDNVKTLEYENPEMSRYMDALVDSNPNVKLKHRFVPLDSISPHLR
KAVIASEDAGFYYHPGFDVRAIAEALDANRYYGKTKFGGSTITQQLAKNLFLSGERSWER
KFKELAYALLMEKMLGKDRILELYLNYAQWGKTIFGCEAASQEYFKKSAFKLNLDQAINM
AAVLASPGKHNPNARYSRFMASRRTVIYQNMFPKRDSLKVDSLKELNAPPEEAKAALPIA
E

Enzyme Prediction     

No EC number prediction in MGYG000003514_00756.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	106	271	3.1e-56	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	5.19e-74	31	271	1	223	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	2.44e-63	106	269	12	175	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	3.80e-63	59	271	7	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.11e-58	41	271	10	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.96e-49	42	272	1	231	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACI21050.1	2.70e-48	59	301	11	249
QAA94289.1	1.76e-47	70	271	25	233
QER42102.1	3.45e-47	66	301	15	266
BCB96894.1	5.03e-47	73	291	22	241
AEH22955.1	1.75e-46	79	268	28	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.57e-36	106	267	19	180	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	3.62e-36	106	267	19	180	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	7.24e-24	99	267	149	319	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	7.32e-24	99	267	170	340	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
4OON_A	1.00e-23	122	271	54	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2YBM4	2.31e-46	69	271	19	224	Biosynthetic peptidoglycan transglycosylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=mtgA PE=3 SV=1
Q3SFZ8	3.82e-45	100	271	55	225	Biosynthetic peptidoglycan transglycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=mtgA PE=3 SV=1
Q7NS41	6.77e-45	48	271	1	222	Biosynthetic peptidoglycan transglycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtgA PE=3 SV=1
A4G8N2	8.14e-44	86	271	37	225	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
Q2SZD0	1.15e-43	86	271	59	247	Biosynthetic peptidoglycan transglycosylase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999818	0.000210	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
42	64