CAZyme Information: MGYG000003514_01560

Basic Information

• Species: Fibrobacter_A intestinalis
• Lineage: Bacteria; Fibrobacterota; Fibrobacteria; Fibrobacterales; Fibrobacteraceae; Fibrobacter_A; Fibrobacter_A intestinalis
• CAZyme ID: MGYG000003514_01560
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41286.21	7.8133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003514	2933446	MAG	Fiji	Oceania

• Gene Location: Start: 1207; End: 2316 Strand: +

Full Sequence      

MLSLCIISVLSALYVSLFLFLSIGLLRAKKNGGQPEKLWSVSVIVPLRNEEEHARRTLEA
LDAQDYSGEWEVICVNDRSTDRTAQILEEFAAGHPRFSVVHIPMDAPFLESPKKRALETG
FKTAKHEILMTMDADCIPPRGWIRSMANRFRGNIAIVQGPKKNSGSPGVVHAFQKLETLG
YTSIEAAGFSMGIPMVASAAALAYKKELFFKVGGFGDLVHLSSGDDDMLVHKMIHEPDVG
FCYNLDKEAVVETAPVDTFKGLLNQRARWSSNGTSYSNHLYTFFLTLIYTFYVWLFVSPW
LALFLNFPWSWFLVPFAVKFAVDVLFLSIGAIRLGETKLLAALPMTELLQVPIITVAVPL
GIFKIFRWK

Enzyme Prediction     

No EC number prediction in MGYG000003514_01560.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	42	163	2.7e-25	0.7

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	1.25e-68	43	271	1	228	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	2.53e-34	43	215	1	172	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.37e-31	1	369	15	378	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd02525	Succinoglycan_BP_ExoA	1.18e-29	40	265	1	219	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam00535	Glycos_transf_2	6.59e-27	42	209	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX75118.1	9.45e-156	6	369	5	367
ADL26413.1	9.45e-156	6	369	5	367
ADL25393.1	4.80e-47	8	369	15	376
ACX75576.1	4.80e-47	8	369	15	376
QKJ99320.1	7.05e-47	14	369	17	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.63e-06	41	135	7	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	4.55e-13	40	273	76	300	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	4.55e-13	40	273	76	300	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q8GLC5	2.47e-09	36	273	44	271	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
D4GYG7	5.02e-09	41	268	8	222	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
Q5HKQ0	5.86e-09	36	273	44	271	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
181	203
282	304
311	333
348	366