CAZyme Information: MGYG000003515_00011

Basic Information

• Species: Prevotella sp900769275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769275
• CAZyme ID: MGYG000003515_00011
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047		117687.66	5.9452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003515	2052370	MAG	Fiji	Oceania

• Gene Location: Start: 16488; End: 19631 Strand: -

Full Sequence      

MKYILSAFIAMLISITVATAQSRRPVDSQHPVWLVHVDVWNQADPQKIIDLIPDDVKPYV
VMNLSLSCAYDTELNIHQRPQNAIPTYKSWATVCQMNNMWFTLQPASGGHTHIHDNDLET
FEYFFKKYPNFLGWNFAEQFWGFNEPGDLFSSSDVDRIELFANLVPMHHKYGGFLTVSFC
GNIWSHHLNPVGMMKRNEKLLQACKDYPEAILWLYKYTTSSCFYNNESVSFGPFVAGLAK
NYGVRYDNCGWNGALEALLGENHGKKYPVAAGIGTVMEQTCQNGGAVWDGPELIWTEDFQ
NLSDGTVTDGSKTYKVRRWGTFPGFRNIWIDMWRKIIDGTMYIPTQQEVIDKTKIIVIND
VKSGSDEDRYAAWGDLYDGLYKQTDPFNRGNGQWLDNFLYLKKTGRYGTIPVTPCLTEMS
SGIPDKVKKTQRTSVWSSQAVKTAKFNQAYPQVSTGDLFVSRYRNQLVTYTPYSYLNGKT
TAKANVPLQYSTCKSLDLTWGKLSSGIIKEYADSVCFYLNNYRTDTTTNVTDRIVINGVT
AEPKLSWSKRVEAKATVTPSWDAAAGTYTLEVSHNGPVDLKVECQGAESDRLTDYVGSTA
LPLPVQPKDYFGTLIIEAEDMDNCNVQDMVQTPYYSSYKWVRGQAGNGFVVMGTNSTGAL
RKVFKVKKGGEYRIAVRYSNTHKDGNVRIRVNDNSAQSKKFYKTASNEWRKDTITATLTE
GENKFYLFNTAGINMMVDQVIFSPADEEIEKFDINIKSAAGGSPIACVEAAEEGETVTVD
ANPAEGYSLKAWNIIHGKIDITENEDGTFSFVMPDDIVTLEPIYVDNTMTYRMDLTNVLE
GTFAPGWRAEMSETSVQQYPNSYGSGPRTFVGFTGTYYKGTYWRGLNCNYGKQDGYKLHL
TPGKYRLSYAMAAWKGTPQYKAQILTSAGNVLSETQYFTATPNANGSKSSDLSSAEEKTM
EFEVKAEGDYIINFYTNGGDWAEFLLLSCCVNKIPESTDIESTVIGTDLTGGEYEIFDEM
GRKLPALKKGINIIRRRGVEVKKVFVR

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	20	341	1.5e-87	0.9908256880733946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	2.13e-88	19	340	4	327	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam08307	Glyco_hydro_98C	5.86e-12	346	582	1	267	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd02795	CBM6-CBM35-CBM36_like	1.58e-05	616	742	2	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.
cd04083	CBM35_Lmo2446-like	4.93e-05	643	732	22	113	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04081	CBM35_galactosidase-like	1.68e-04	616	732	3	115	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	1	1046	1	1034
AJQ96076.1	5.08e-164	32	743	1	696
AOZ99817.1	3.72e-162	23	827	37	829
AVS63470.1	3.12e-159	20	740	55	765
AVS65814.1	8.67e-159	20	740	55	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	7.76e-11	50	582	64	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMH_A	1.02e-10	50	582	64	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMG_A	1.35e-10	50	582	64	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000412	0.998911	0.000174	0.000181	0.000164	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003515_00011.