CAZyme Information: MGYG000003515_00320

Basic Information

• Species: Prevotella sp900769275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769275
• CAZyme ID: MGYG000003515_00320
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000003515_38|CGC1	36486.65	8.025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003515	2052370	MAG	Fiji	Oceania

• Gene Location: Start: 8873; End: 9838 Strand: -

Full Sequence      

MKKVILTTIITLMSAVSLQAQVSDNPDTLVVARDGTGQFRNIDEALEVCRAFMEYHKVIY
VKKGIYKEKLILPSWLTNVEICGEDRDNTIITYDDHANIKSDEIHSKSQKIGTFRTYTLR
IDGTDITVKNITIENNAPRLGQAVALHTEGNRIKFLNCRFLGNQDTVYTGRGETTLLFKD
CYIEGTTDFIFGPSTAWFENCDIHCKVNSYITAASTPQNVTYGYIFNNCRVTLAPEVTKM
CLGRPWRTYAHTVFMNCELPKGIAPGGWNDWKKDVKLVRYAEYNNRGEGAQPDKRVEWSR
QLTKKEAKELTIANVLGKWAE

Enzyme Prediction     

No EC number prediction in MGYG000003515_00320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	316	1.4e-96	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	9.57e-72	29	310	7	290	pectinesterase
pfam01095	Pectinesterase	1.49e-71	30	317	3	296	Pectinesterase.
COG4677	PemB	7.04e-60	22	319	76	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.47e-57	28	308	70	353	pectinesterase family protein
PLN02745	PLN02745	1.76e-55	30	319	288	583	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	1.99e-151	1	318	1	316
ADE82952.1	1.99e-151	1	318	1	316
QJR97878.1	2.69e-148	24	315	17	309
BCS84477.1	1.53e-144	1	315	1	314
QNT66521.1	2.64e-136	1	320	1	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.96e-36	29	298	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.33e-35	30	298	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	2.68e-34	29	321	11	296	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.43e-33	29	321	11	296	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.79e-28	58	319	36	337	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.79e-50	31	307	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	5.98e-47	28	316	272	567	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	9.65e-47	28	316	259	554	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q9FJ21	1.32e-44	29	316	260	553	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q43043	3.17e-44	21	298	51	332	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999080	0.000180	0.000166	0.000154	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003515_00320.