CAZyme Information: MGYG000003515_00733

Basic Information

• Species: Prevotella sp900769275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769275
• CAZyme ID: MGYG000003515_00733
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	MGYG000003515_86|CGC1	97033.85	5.6981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003515	2052370	MAG	Fiji	Oceania

• Gene Location: Start: 17015; End: 19552 Strand: -

Full Sequence      

MKKVFSLFLLILCCYSSVQAATDFVTFTEGAGTMPLTSGGDTVVYAPGEWEGVKMAVEDL
RQDLIAVTGSPCAPITVATVDKSPIAGKYPGYAKQLRGKWEQFLIIVDADAHNIVVLGSD
KRGTIYGIYELSRQLGVSPWYWWADIPVARHPDVYVRPGVYTDGEPKVKYRGIFINDENP
CMQRWAQLKFGGMNSKMYKRVYELLLRMKANLLWPGMWGTFKEYRPMVPVMQNPDGTLEG
NCFNWDDPDNPRLADIMGIVVGTSHHEPMQRSQQEWVRTKQNYGNGEWNYLTNEEGLKRF
FREGIENTKDYESMITVGMRGDEDRPMADAGGREANMCLLKRIFDDQRSIIKDVMGRKAR
QTPLVWTLYSEMLDYYDDGFHVPEDVTVMLCDDNWGDIRKIPTEDVRNSRGGFGMYYHFS
YYGAPRAMKWLQQMQIQQTWQQMDLAYRSGIDRVWIVNVGDIKPAEFATQFFMDMAWNPT
CFHPDNLMDYTVDFCRPFAREYAKEAARILNLYNKYAARITAEMLDDRSYSLATGEWKQV
RDEFLVLEAEALRLNEQIAPEARDAYREIVLFPVQALANLYDMYYSLAMNRYLAELSDPE
ANEYADRVEKCFERDSLLTLYYNKVMADGKWDGIMTQVHIGYTTWHGPQYNVMPKVSRVA
TAPTVRRGGYVFREHGGEVVMNAEHYYEAIAPEGMAWTIIPHLGKTASALELRGVGDCRK
GDITYRMTLPSCPSKVKVRLVFSTVMPFVKGGHDVETWFEGCGSVVRNLNKDMNWQHCYD
LMYPAGAARVIEIEQEMEARPVKDDVYQLHIRPLTPGLVLQRIVVDLGGYRPSMLHGKES
DYVRQ

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	41	823	4.8e-230	0.9813486370157819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	6.21e-166	164	524	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.35e-14	669	835	1	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	6.78e-04	73	131	62	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV03678.1	7.05e-282	16	844	21	856
QUT78599.1	3.15e-279	1	842	3	839
QUT26888.1	3.15e-279	1	842	3	839
ALJ58215.1	2.11e-278	16	844	21	856
APS38643.1	3.34e-278	42	845	56	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.26e-254	1	845	12	854	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.68e-244	49	840	34	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.29e-242	49	840	33	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	5.36e-152	49	660	31	635	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	4.28e-107	75	659	65	658	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999071	0.000213	0.000155	0.000151	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003515_00733.