CAZyme Information: MGYG000003515_01047

Basic Information

• Species: Prevotella sp900769275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900769275
• CAZyme ID: MGYG000003515_01047
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000003515_116|CGC1	36020.86	6.8215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003515	2052370	MAG	Fiji	Oceania

• Gene Location: Start: 10098; End: 11060 Strand: +

Full Sequence      

MRTTLTLILSLLVMMTKADTFDLIIAADGTGDYTSVQEAINAVPDYRKKQTRLFVKAGVY
KEKVVIPESKSDIVLIGQNCDNTIIQYDDFAQKKNIFGEDKGTSGSASFYVFSPDFRAEN
ITFANTAGPVGQAVAMFVAGKRCIFINCKFKGFQDTLYTFGKQSKQLYKNCYIEGTVDFI
FGSSTAFFDNCRIHCLNRGYVTAASTPEGTPFGYVFRYCRITAEKGLDGIYLGRPWRPFA
KTVFIGCTMGKFITPAGWHNWGDSNKEKTALYGEVDSEDYDGHPIDLTQRAAWAHRINPE
DYEIDRVLADAERPNWYRVE

Enzyme Prediction     

No EC number prediction in MGYG000003515_01047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	23	300	7.6e-96	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	6.93e-82	23	316	7	305	pectinesterase
PLN02682	PLN02682	8.79e-79	29	301	78	351	pectinesterase family protein
pfam01095	Pectinesterase	9.53e-76	22	301	1	284	Pectinesterase.
PLN02432	PLN02432	4.08e-66	29	301	19	276	putative pectinesterase
COG4677	PemB	2.03e-63	26	279	88	376	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH38247.1	7.85e-121	22	303	24	302
QEC43391.1	2.32e-120	21	310	27	316
APU94947.1	2.25e-118	16	316	18	313
ALW87057.1	3.82e-118	21	304	21	301
QDA58582.1	5.60e-118	1	316	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	8.49e-45	22	277	8	268	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	9.32e-43	24	293	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	4.91e-35	16	277	4	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.62e-34	16	277	4	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	3.58e-34	17	272	27	317	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.53e-61	25	274	9	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	3.32e-59	31	319	94	383	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	2.90e-52	24	316	274	566	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	2.25e-51	24	293	278	552	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
O23038	5.87e-51	28	298	96	369	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000334	0.998881	0.000256	0.000162	0.000167	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003515_01047.