CAZyme Information: MGYG000003516_00594

Basic Information

• Species: Methanobrevibacter_A sp900769095
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanobrevibacter_A; Methanobrevibacter_A sp900769095
• CAZyme ID: MGYG000003516_00594
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000003516_100|CGC1	36566.15	9.348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003516	1591883	MAG	Fiji	Oceania

• Gene Location: Start: 3761; End: 4720 Strand: +

Full Sequence      

MKVSVVTPNYNGERFLKTFLESLNEDSEYIGEVIIIDNGSSDSSIDYLKNNKFNFPLVLI
ENKENVGFSPAVNQGIRKAKNSLIFSINNDTEIKKGSIKKLIDLITSSDDIFSVQAKMLQ
YNNKDLIDDVGDEYNLLAWTKKVGENHKSSEYVEVRDIFSSCAGAAMYNKSILEEIGLFD
DNFFAYMEDVDLAIRSRINGYRNLLCPEAIVYHIGSATSGSRYNEFKVKLAARNNVWVVY
KNIPIPLKILNFVFLFLGFLIKYIFFCKKGFGKTYMAGLREGLSTRSKIDKVKFESKNTK
NYFKLEFRLIINTIKFLKR

Enzyme Prediction     

No EC number prediction in MGYG000003516_00594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	176	1.2e-22	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.88e-49	1	289	3	293	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.53e-44	5	215	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	7.28e-19	2	213	1	207	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam00535	Glycos_transf_2	4.19e-18	4	173	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.23e-16	5	202	1	153	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD16621.1	8.48e-200	1	319	1	319
ALT70013.1	4.06e-170	1	319	1	318
ABQ87534.1	9.61e-165	1	319	1	321
ATZ60521.1	1.12e-163	1	319	1	321
ADC45963.1	9.25e-136	1	319	1	327

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O06483	5.07e-09	1	102	1	103	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2
P11290	3.46e-07	2	109	7	114	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
Q57287	7.69e-07	3	253	7	258	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
Q9RQP9	4.07e-06	32	225	78	263	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	4.07e-06	32	225	78	263	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
249	266