CAZyme Information: MGYG000003517_00131

Basic Information

• Species: UBA3766 sp900769175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3766; UBA3766 sp900769175
• CAZyme ID: MGYG000003517_00131
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	MGYG000003517_15|CGC1	59340.38	5.9688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003517	2831393	MAG	Fiji	Oceania

• Gene Location: Start: 6505; End: 8070 Strand: -

Full Sequence      

MIDSVVNQTYPDWELILADGSDDAHAYVGEISLEYAKRDSRIKYKKLEKNEGISGNTNQC
YRMASGDYIGLFDHDDILHPSAFYEYRRAIDEQGADYVYCDEATFTGNSIDHMITLHFKP
DYAIDTLRANNYICHFSLFKKELLAETELFRTEFDGSQDHDMILRLTSLAKNVVHVPRIL
YYWRAHAGSVASDINAKLYCIDAAKRAVADHLRHYGIYNTLITSTRAFETIFRLQYEITS
KDKVSVIIPCTEPGKELLSCVDSIEKYNSYDRIEIIIVDHESRQKESLDILEELSKNALV
RMVHSKGAFHKAKLLNLGAKAATGGMLLFIHPALLMASSDFISELLMYTQREDVGAAGAK
LLFENDDIQHAGMILGIGENHIAGHIHYGFGNSHIGYMGRLCYAQNMTAVSGDCLMVSKK
NYDAVGGFDERFVSALYDVDFCLKLRRLGKLNVFTPFAEGYLNEVPMLHREKTKEAKERF
DAECRAFAELWKTELEKGDPYYNPNFSKDKFDYTLRIVEKS

Enzyme Prediction     

No EC number prediction in MGYG000003517_00131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	144	2.1e-20	0.8764705882352941
GT2	245	422	1e-15	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.74e-72	1	185	20	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06433	GT_2_WfgS_like	2.21e-22	2	189	17	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	8.16e-21	1	144	16	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04186	GT_2_like_c	1.33e-18	246	461	1	163	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02522	GT_2_like_a	6.36e-17	244	451	1	175	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	8.36e-199	1	517	115	630
ADL33299.1	4.00e-194	1	517	135	673
AOZ95572.1	3.94e-192	1	517	135	675
QNM02106.1	9.32e-191	1	516	135	678
QMW89744.1	1.95e-173	1	517	102	616

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.14e-82	1	515	385	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.00e-59	4	516	341	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.14e-07	2	165	28	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	2.93e-07	2	190	22	221	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q54QG0	8.19e-06	2	110	35	146	Bifunctional glycosyltransferase pgtA OS=Dictyostelium discoideum OX=44689 GN=pgtA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003517_00131.