CAZyme Information: MGYG000003517_00895

Basic Information

• Species: UBA3766 sp900769175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3766; UBA3766 sp900769175
• CAZyme ID: MGYG000003517_00895
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		72383.87	9.6998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003517	2831393	MAG	Fiji	Oceania

• Gene Location: Start: 29652; End: 31496 Strand: -

Full Sequence      

MDYIFEFVLRHFHIIELIVFWYPVVMSLLWIVGSVIYYFRIERKDPLPLPDTPMVSVLVP
AFNESANLIEVIRRLNEMDYPNYEIIIINDGSHDDTAQYARNLSEKYERVRFVDLEVNCG
KANALYLGLMAAKGEFLICVDGDSYLDKNCIRYMMAHFLNPNNGERVGAVTGNPRVRNRS
SLFAKIQLCEYASIISMIKRTQRIWGKVMTVSGVVVAYRKRALLDCGLWDRDMVTEDIAV
TWKLERNFWDIRYEPNALCWMLVPESLKGLIKQRKRWAQGGQEVMLRHAGIFKSWRRRRM
YPVYFEQIMSIAWVLLWLLLTVTEIYKLAYNMDSYIPYIWKSQFLSVVCMIQFTVALLLE
SRYDKGIFKYMISAAWYPIIYWVVNGMVSLMALPGTIFKRKQKLVTWKSPDRGIKTSSEK
KDKMEFGPQKRNSGTDERNKTEFQNKSDKQEHIIDGKQVWWKKILEFLASSLAWAFILVF
FAYVTYGFICLALGKTPVSVWIYDVEMLLETRKLLLIALIVLLVEIVVMIFWKEYNRLRF
GKLRRRTFMPDVTTQELSELFEIPYEDLLKYQTEKIITFTDNPIKKDFKAEGRKYNSDRK
NGNRNYGSKAHNRL

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	53	278	1.7e-37	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03937	PgaC_IcaA	0.0	19	413	5	407	poly-beta-1,6 N-acetyl-D-glucosamine synthase. Members of this protein family are biofilm-forming enzymes that polymerize N-acetyl-D-glucosamine residues in beta(1,6) linkage. One named members is IcaA (intercellular adhesin protein A), an enzyme that acts (with aid of subunit IcaD) in Polysaccharide Intercellular Adhesin (PIA) biosynthesis in Staphylococcus epidermis). The homologous member in E. coli is designated PgaC. Members are often encoded next to a polysaccharide deacetylase and involved in biofilm formation. Note that chitin, although also made from N-acetylglucosamine, is formed with beta-1,4 linkages.
PRK11204	PRK11204	0.0	12	415	7	419	N-glycosyltransferase; Provisional
PRK14583	hmsR	3.89e-122	19	414	34	439	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	2.13e-60	14	309	10	312	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.32e-59	57	237	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT53490.1	3.27e-181	13	414	3	404
AGF55692.1	1.49e-172	19	414	12	407
AUW93083.1	1.94e-145	19	414	8	406
AUB67139.1	3.85e-144	14	414	4	404
AEN88274.1	2.87e-138	19	417	18	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	1.29e-12	53	162	13	122	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5EJ1_A	2.81e-10	42	293	115	387	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.95e-10	42	293	127	399	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.95e-10	42	293	128	400	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
5HEA_A	1.15e-08	54	191	6	140	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	4.14e-104	13	413	2	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	8.23e-104	13	413	2	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q8XAR5	1.75e-101	11	414	23	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	3.48e-101	11	414	23	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q99QX3	1.06e-97	22	413	10	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000089	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
17	39
308	330
337	359
379	398
472	494
514	536