CAZyme Information: MGYG000003517_02008

Basic Information

• Species: UBA3766 sp900769175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3766; UBA3766 sp900769175
• CAZyme ID: MGYG000003517_02008
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		46258.56	4.0503

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003517	2831393	MAG	Fiji	Oceania

• Gene Location: Start: 3003; End: 4220 Strand: -

Full Sequence      

MKKRLALLLTGLLILSVAGCAGTGNYAAGAETDSSSEVLQSEPENGSDDGTESGNDVWTE
ELYLQKVFAEHDMKVGTCLSTQMIHNEQTKQIILDQFNSVTMENSMKPDYLFNKEESIAA
GELVVEFDKDALEMMEFAKENNLAMRGHTLIWYSQTPDWIFYEDFDTGKNLVGREVMLSR
MESYIKQVFEQLTELGYADLFYAYDVVNEAWMDDGSMRENNWSATIGDDYLWQAFYYADQ
YAPEHIDLYYNDYNEQYKTGALLEFVDTLKDENGNYLIDGVGFQAHLYTGDNLNKYFRTI
DSISATGLKIQITELDVSLGTWQNTLEPTDVNLKVQGKFYYDLVNGLFERKEAGTLSMDS
LTFWGFADELSWRKEASPLLFDQNFQPKYSFFGAMQMKERAGLGQ

Enzyme Prediction     

No EC number prediction in MGYG000003517_02008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	64	395	2e-83	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.35e-80	64	393	1	307	Glycosyl hydrolase family 10.
smart00633	Glyco_10	3.83e-75	106	393	1	262	Glycosyl hydrolase family 10.
COG3693	XynA	2.32e-54	97	388	58	331	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX05674.1	1.05e-150	64	402	38	376
ADX05683.1	5.14e-150	62	402	71	411
AEV59727.1	7.50e-143	64	402	114	450
CUH92739.1	1.51e-141	64	402	89	425
BAF93203.1	2.26e-78	1	400	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NL2_A	2.55e-53	64	403	12	346	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]
5Y3X_A	2.21e-52	74	392	41	352	Crystalstructure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_B Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_C Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_D Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_E Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_F Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL]
2Q8X_A	5.32e-49	64	397	8	331	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	7.46e-49	64	397	8	331	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	4.03e-48	64	397	8	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	9.75e-56	66	396	4	336	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	8.48e-50	106	396	1	300	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
P29126	1.91e-47	64	397	630	952	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
P51584	1.39e-46	50	391	181	532	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P23556	4.28e-46	62	392	15	337	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000045	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27