CAZyme Information: MGYG000003520_00049

Basic Information

• Species: RC9 sp900769145
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769145
• CAZyme ID: MGYG000003520_00049
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		27115.71	10.2321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003520	2768956	MAG	Fiji	Oceania

• Gene Location: Start: 4212; End: 4913 Strand: -

Full Sequence      

MKLKTRIKRISKILFLYVPAGLILLSIAWVTLYKFVPVRWTPLMLKRSIEYRDQKDFRNH
QIWVDIDDISQTMVTAVIASEDGRFMDHWGFDFEAIREMKKSHEKKGTKIRGCSTISQQT
AKNCFTFGSKTWLRKGVEAYYTFLIEIIWGKKRIMEVYLNVAETGKGLYGVEAAAEKYFH
CHASKLTRDQAICIACVLPNPLVRNPQTAAQRHRTKYNNVSNTMKYVSYPFTP

Enzyme Prediction     

No EC number prediction in MGYG000003520_00049.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	58	225	2.4e-49	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	6.38e-90	1	206	2	205	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	6.61e-72	8	230	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	5.02e-55	57	225	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	8.69e-52	1	225	5	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.02e-28	1	214	2	224	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR44737.1	7.67e-61	7	226	2	216
AGY53411.1	2.52e-60	2	231	4	232
QXP80527.1	9.93e-60	23	217	16	210
AXG73594.1	1.87e-59	23	227	17	221
AWW30851.1	8.25e-59	24	206	17	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.49e-25	61	224	20	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.76e-25	61	224	20	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	1.13e-19	61	228	40	210	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	1.94e-14	64	215	30	185	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.21e-13	64	215	39	194	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q11VI0	2.46e-57	30	230	35	237	Biosynthetic peptidoglycan transglycosylase OS=Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465) OX=269798 GN=mtgA PE=3 SV=1
B7UJU8	4.80e-54	22	202	20	205	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=mtgA PE=3 SV=1
A1AGA9	1.36e-53	22	202	20	205	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O1:K1 / APEC OX=405955 GN=mtgA PE=3 SV=1
Q0TCQ1	1.36e-53	22	202	20	205	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=mtgA PE=3 SV=1
B7N364	1.36e-53	22	202	20	205	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O81 (strain ED1a) OX=585397 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000005	0.000000	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
13	35