CAZyme Information: MGYG000003520_01826

Basic Information

• Species: RC9 sp900769145
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769145
• CAZyme ID: MGYG000003520_01826
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000003520_180|CGC1	44011.65	8.9671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003520	2768956	MAG	Fiji	Oceania

• Gene Location: Start: 9253; End: 10419 Strand: -

Full Sequence      

MKYYIIAGEASGDLHGSNLMKGLYARDPEADIRFWGGGLMNEVYKAHQCGEGLVQDYKDG
AVIGFIQVLFKARAYADRFKRCFNDILSWNPDVVILIDFPGFNFRVAEFAHKKGYKVFYY
IAPKVWASRESRVKKIKAYVDKLFIVFPFEIPYFTRKGIDFIYKGNPLLDAIDNSPLMNM
GRRDFLQDNNLEDRPSIALLAGSRSGEITSMMPTFASFADAMRKIPEYSEYQFLIAAAPN
RTKEDYAQWTRGRESYLKVIFNQSYAVIRHSVAAVVNSGTASLETALIGTPQVVAYKGMR
INFAIAKLIIKINFISLGNLILGRTCFRELIQDYFTTENLVNEVRRLIEDNEYRTTMLSG
YEEIRNSLGGKGASEAVADAMIAELKKD

Enzyme Prediction     

No EC number prediction in MGYG000003520_01826.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	368	1.5e-102	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.17e-102	1	387	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	3.53e-102	1	387	2	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.90e-75	4	369	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.19e-55	5	383	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.50e-55	1	379	2	342	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY31424.1	9.79e-111	1	386	1	374
SNV26174.1	9.79e-111	1	386	1	374
AFD07892.1	1.78e-109	1	388	1	370
ADY50863.1	1.26e-108	1	385	1	366
AGY53532.1	1.34e-108	1	386	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.02e-32	5	382	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.03e-31	5	382	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	3.82e-72	5	387	11	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	7.53e-65	5	387	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	4.27e-64	5	387	11	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	2.36e-63	5	387	11	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	1.58e-55	5	385	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999860	0.000191	0.000008	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003520_01826.