CAZyme Information: MGYG000003520_01927

Basic Information

• Species: RC9 sp900769145
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769145
• CAZyme ID: MGYG000003520_01927
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000003520_189|CGC2	65080.1	4.8589

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003520	2768956	MAG	Fiji	Oceania

• Gene Location: Start: 42740; End: 44527 Strand: -

Full Sequence      

MRKHLSYIVLAMMAFQCVLSACGCSKGEEPEPGKPAGENSGFTISPESLSFEAGGGSRYV
NVTGPEGWVAELENGDAWCSVTRNSDTRLTVKAGVNEGGLRTASVVLKAGSETGRISVSQ
EASDKVIEEDVFPANADYTVEILRSGSWEPLFVHNAKVSDYAGNPEAGYTQYDMGFVMFT
DEFQSPVRLRITRATAFSNVEIRPSAYGIKPAARSGKSIEIEIPGPEKKISVEFDGDRMR
NLFIFPDLPEQDKPSGTNVTYFGPGVHNVGLISPKSGQTIYIDEGAVVLGRIKAENASNL
TIAGRGILCGSRENHGDGRLPQIELLKCNNLTIKGIMLRDTPNWTIKMTGCNGVHIDNIK
EIGWIMNSDGMDFICCRNVLVENTFQRNYDDNVTIKAFNAKPEYIASHTADDGSYTDGTI
WMVNALTEFDVDNIEVRNCVFWADKAHNMVVGPESRGIPFTNIKFIGNTVLENRQNDSVY
PGTMAVMIADNGTFSDISFEDITVEDINGGKVICVHFANAWAFDNLYGQWARNITFRNVT
YNGSRASKSWVRGLDASHVIDGLAVSGLKFNGTAVTNGSGSYFEVNSYVKNIKFE

Enzyme Prediction     

No EC number prediction in MGYG000003520_01927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	290	576	8.3e-37	0.7538461538461538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14948	BACON	2.50e-13	42	121	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
COG5434	Pgu1	2.90e-12	323	509	241	434	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	2.94e-08	264	507	12	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
pfam19190	BACON_2	9.92e-08	42	123	2	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
PLN03010	PLN03010	8.61e-06	292	466	133	308	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63844.1	3.56e-241	130	595	11	479
AFL77441.1	1.89e-240	130	595	28	496
AFL77442.1	1.05e-227	133	595	290	757
QQA09746.1	5.18e-83	146	595	56	506
QQT79215.1	5.18e-83	146	595	56	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	1.21e-08	270	457	150	315	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000595	0.999439	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003520_01927.