CAZyme Information: MGYG000003520_02125

Basic Information

• Species: RC9 sp900769145
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900769145
• CAZyme ID: MGYG000003520_02125
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42093.23	4.974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003520	2768956	MAG	Fiji	Oceania

• Gene Location: Start: 208; End: 1326 Strand: +

Full Sequence      

MAQKYHRKRRIVFKYILPPIAVILIVPMLQKTVIQDVPFDKEVIRCVITVDRKTSAMNYG
AGYHYELLKLFSSQIGLEEEIALGGREYLDSLECGAVDLVVVPASDSLLNERDLFYSIPL
ADSSTWVIRKDLEAEIRSINNWLAHYFTTESHRLALERFTPAYEPFRRAATGRKYSILSP
YDALIGEYAARIGWDRLMLTALVWKESQFHIEVVSPRGAVGLMQVMPRTAEHFGAGNMID
PEENISTAVKLLDRLQKMFRNDAADSAELMKFTLAAYNAGEGRLRDCIAYAKSIGAPYGR
WDDLVAIIPDMREDSILDHESVKLGKFQGYETINYISLMEDYYDAFCAIACGQSSPGPLW
TQTDTEEATEAL

Enzyme Prediction     

No EC number prediction in MGYG000003520_02125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	198	346	2.3e-21	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	4.60e-51	187	348	3	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	7.43e-24	78	372	158	446	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd00254	LT-like	1.22e-23	198	289	3	90	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	5.18e-22	180	285	3	110	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	7.09e-22	185	293	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRY96252.1	1.29e-123	4	299	2	297
AGY53417.1	1.02e-48	62	348	60	349
AHM60830.1	9.46e-35	40	336	178	488
BCI64481.1	1.09e-33	77	346	188	453
AEW20453.1	2.35e-33	83	346	187	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	8.30e-10	181	294	453	579	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.47e-09	181	294	453	579	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	2.00e-23	86	344	182	446	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A1U3J1	1.14e-16	178	349	283	451	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q0AQY9	1.41e-15	178	342	286	447	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
Q0A9T8	8.05e-15	65	344	166	443	Membrane-bound lytic murein transglycosylase F 2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF2 PE=3 SV=1
A8GI11	2.14e-14	176	342	285	446	Membrane-bound lytic murein transglycosylase F OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.947185	0.048742	0.001082	0.000364	0.000225	0.002415

TMHMM  Annotations     

start	end
12	29