CAZyme Information: MGYG000003521_00213

Basic Information

• Species: Parabacteroides sp900770835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900770835
• CAZyme ID: MGYG000003521_00213
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609		69226.88	7.434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003521	2802496	MAG	Fiji	Oceania

• Gene Location: Start: 31; End: 1860 Strand: +

Full Sequence      

MYLNKFDFLYNAVGIQSAARVYFGKTPKTLSIEEAATLVGMCKNPSYFNPVRHNERTLGR
RNTVLRQMEKAGYLSKADCDSLCALPLTLHFTRMDHKDGLAPYFREYLRLTLTAKKPNRK
DYASWQSQKFSEDSLSWETNPLYGWCNKNKKADGEFYNLYTDGLKIYTTIDSRMQRYAEE
SVREHMSKDLQPAFFKEKQGRSYAPFSKDVSAGQIDTMLMRAMHQTDRYRAMKKEGMSEQ
EMRKVFEKPVDMRVFSWNGPIDTLLSPMDSIRYHKSFLRTAFMSMEARTGHVKAYVGGID
YNDFQYDMVNGGRRQVGSTMKPFLYSLAMIEGISPCDQMLHVQQQLMDENGRLWVPRNAS
AKRVGEMVTIKWGLQNSDNWVTAYLMSQLSPYTFVRLLHSFGLKNEIDPVISVCLGTPDV
SVGEMVGAYTVFANRGIRVEPLYVTRIEDSFGNTIANFSPQMSEVLTEEAAYKMLHMLRS
VIDGGTGGRVRFRYGIKAEMGGKTGTTQNNSDGWFMGFTPSLVSGCWVGGEDRSIHFDRL
AEGQGASMALPIYALYMQKVYADKTLGYSEAESFEIPERFLDPCGTEEAEGEEKPVIAPD
TGGIDKMFE

Enzyme Prediction     

No EC number prediction in MGYG000003521_00213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	1	69	8.5e-22	0.384180790960452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	9.35e-102	1	563	98	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	3.47e-95	2	564	164	722	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	2.06e-94	1	563	173	599	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.61e-49	1	558	162	782	penicillin-binding protein 1a; Provisional
TIGR02071	PBP_1b	6.63e-47	14	559	260	681	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT55103.1	0.0	1	609	175	781
QUR50007.1	0.0	1	609	175	781
ABR43557.1	0.0	1	609	175	781
QRO16257.1	0.0	1	609	175	781
QUT22137.1	0.0	1	609	175	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UDF_A	5.19e-49	1	557	135	712	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	2.56e-42	1	583	135	744	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3ZG8_B	8.80e-32	1	529	15	431	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
5U2G_A	9.43e-26	1	564	136	761	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3ZG7_B	5.21e-25	2	529	16	431	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.65e-52	1	577	159	679	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87579	1.46e-48	1	558	164	703	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
O87626	3.14e-47	1	557	164	701	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q9KNU5	2.32e-46	1	563	162	760	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
P0A0Z5	4.91e-46	1	558	164	703	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003521_00213.