CAZyme Information: MGYG000003521_00650

Basic Information

• Species: Parabacteroides sp900770835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900770835
• CAZyme ID: MGYG000003521_00650
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000003521_196|CGC1	56886.9	8.1185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003521	2802496	MAG	Fiji	Oceania

• Gene Location: Start: 2073; End: 3605 Strand: -

Full Sequence      

MKKYLSFLGSLICLLQPLQAEEIKTAEKDTLDTIENEIGLIPESLDSNVDSLLHSWHVQY
FTQEEDFCHDDNTNINFPDSVYADRLNRLPSLISLPYNHIVGDCIKLYAERKRDLVRYML
GMADFYFPIIEEVLDQHNLPLELKYLAVVESALNPVALSRVGASGLWQFMLPTGKIYGLE
INSLVDERRDPKRATEAACAYFKDMYAIYGDWNLVMAAYNCGPGNVNKAIRRAGGKRDFW
TIFPYLPRETRSYVPLFIAASYIMNYYCDHNLCPLQTSLPLATDTVMVNQALHLQQVSEV
LQLDLATLRALNPQYKRDIIPGNNRPSVLKLPAAATYAFVGKEDTVYKHRMEDYLANIVT
SSTNPSGSKSTREQITHVVQAGENLYTIANRYGLTAKEIRKWNGLGSNRVAKGKRLKLYV
DNGGIAFANTNSKAPTATTKTSSKATSTQGAATQAADSNKGFIAYTVKAGDSLYTIAKKY
PGVSTKDLQQINGLTSSDIRPGQVLKIPVS

Enzyme Prediction     

No EC number prediction in MGYG000003521_00650.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	126	259	1.2e-23	0.8666666666666667
CBM50	465	508	3.5e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	4.35e-69	134	262	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.29e-59	123	510	101	449	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	5.25e-29	137	236	9	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	4.46e-20	335	507	272	449	1,4-beta-N-acetylmuramoylhydrolase.
cd00254	LT-like	9.32e-20	149	267	10	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE29305.1	4.19e-279	1	509	1	514
BBK92552.1	2.42e-277	1	509	1	510
QUR47840.1	2.42e-277	1	509	1	510
QIX64548.1	2.42e-277	1	509	1	510
AST55280.1	1.40e-273	1	509	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	1.42e-07	461	508	1	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	2.67e-06	465	508	5	47	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	3.58e-35	70	507	48	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	3.58e-35	70	507	48	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
Q5HRU2	3.99e-12	358	508	67	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	3.99e-12	358	508	67	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
P32820	5.91e-11	125	238	25	138	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004979	0.992598	0.001758	0.000243	0.000202	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003521_00650.