CAZyme Information: MGYG000003521_01292

Basic Information

• Species: Parabacteroides sp900770835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900770835
• CAZyme ID: MGYG000003521_01292
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		26587.68	4.9439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003521	2802496	MAG	Fiji	Oceania

• Gene Location: Start: 10; End: 735 Strand: +

Full Sequence      

MASSREGLAKGEADLWDSGQIRSEACTGVAYDGAPLSAQQLAYWRVCVWDREGNRSEWSE
PALFGIGLLRPEDWSPSTRFIGMPDNDQSSLLLRKRPTRAPQGERYLLHVNSLGYHEVYI
NGKAISEAVLTPAVSQFNKRSQIVTYDVSSFLKEGDNDIVLWLGNGWYRADLPGVVAGGP
YVRAELHAISQDGNTLICETDHTWQVRPSGYASFACSDTELNAIHDMVHRTLEALTLGGA
T

Enzyme Prediction     

No EC number prediction in MGYG000003521_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM67	86	210	7.4e-16	0.6761363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08531	Bac_rhamnosid_N	1.02e-30	95	207	1	113	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH96607.1	9.67e-70	1	214	70	281
SCD21033.1	3.83e-59	1	212	72	285
CEA16350.1	3.94e-57	1	211	74	304
QGY42782.1	4.44e-57	1	211	68	278
BBD46114.1	3.14e-56	1	211	71	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.59e-19	1	168	73	254	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	9.26e-13	17	205	51	252	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	5.79e-08	105	205	318	422	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.37e-27	1	205	73	308	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.15e-24	1	215	74	300	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	9.29e-09	1	67	511	577	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
Q82PP4	3.16e-07	105	205	318	422	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996584	0.003291	0.000094	0.000021	0.000010	0.000049

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003521_01292.