CAZyme Information: MGYG000003525_00015

Basic Information

• Species: RC9 sp004556005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp004556005
• CAZyme ID: MGYG000003525_00015
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499		54324.08	5.0096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003525	2213098	MAG	Fiji	Oceania

• Gene Location: Start: 16535; End: 18034 Strand: -

Full Sequence      

MRIKWIMLLAGLLLAACKPEEQKAKKPVKLSVSPEELSFTAEGGEAELIVTAGESPYVTP
WDKWIECRKGSYADNKLAVTVKVEKNSEEKERSSKISIVCGDEKVYVEVAQEAADNRPVK
DDNAAWAVAEKLGIGWNLGNQMDANANGVASETCWGNAKATQAALNAVAKAGFKTVRIPV
TWLGHIGEAPDYKLDETWLERVAEIVGYAENAGLNAIVNIHHDGADSKYWLNIKEAAGNA
TRQQEIVAQLSAIWSQIAVRFKDKGDFLMFECCNEIHDGSWGWGANRTDGGAQYRCLNEW
NAAFVKAVRATGGCNADRLLGVPAYCTNIDLAIESFVLPEDSAKDKLMLSVHCYDPGDYC
LSAKKSQWGHTADTSKKVAGDNEADLKASFEKLFEHFVSKGIPVYLGECGCVNRGNAVEQ
AFQQYYLSYFARLASLYGVPALLWDNGATGSGNESFGYINHSSGAYCSKGAEEAVKALVS
SYNSGESLDAVYDKAPQNK

Enzyme Prediction     

No EC number prediction in MGYG000003525_00015.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	151	447	2.3e-91	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.81e-52	147	448	11	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.34e-20	135	410	54	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	4.39e-14	30	112	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	0.001	30	114	2	91	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	0.002	58	112	5	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX74201.1	1.43e-175	6	498	4	513
ALJ60576.1	1.71e-163	15	497	21	512
QUT88430.1	8.85e-156	39	497	136	598
ADY35478.1	4.89e-151	30	497	121	592
QRX62664.1	3.38e-145	38	497	46	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	8.39e-149	128	478	27	378	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	1.70e-120	122	498	4	387	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	1.36e-119	122	498	4	387	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	4.66e-66	128	462	38	377	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6MQ4_A	3.33e-64	122	463	9	333	ChainA, cellulase [Acetivibrio cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	1.69e-63	113	450	32	372	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
Q12647	2.87e-62	128	462	28	346	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23660	1.73e-58	112	462	15	346	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	2.23e-58	122	479	40	369	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	3.07e-58	122	467	39	362	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000048	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003525_00015.