CAZyme Information: MGYG000003525_00021

Basic Information

• Species: RC9 sp004556005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp004556005
• CAZyme ID: MGYG000003525_00021
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000003525_1|CGC1	93630.72	4.625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003525	2213098	MAG	Fiji	Oceania

• Gene Location: Start: 28235; End: 30751 Strand: -

Full Sequence      

MAGRKLIPFLLLFSILTSACNRSSEAFVHVENGQFVSSANAEYFIGTNFWYGPILASEGR
GGDRERLHAELDALKNLGVTNLRILVGADGPEGIATRVEPTLQPSPLVYNDTLLRGLDYL
LDQMAAREMKAVLYINNAWEWSGGYGMYLEWAGAGKAPIPAEIGYPAYTEAVSAFVTNEE
AKRLFASHLSNIVSRTNSITGKPYRDDPTIFSWQICNEPRCFSDDPKVREQFVQWLRESA
AQIKSLDSNHLVSTGSEGSFGCEQDIELFERIHSCPDIDYFTIHIWPYNWSWAHADKLLG
DLDTAIARSGRYIDEHLAVAQKYGKPVVIEEFGYPRDGFISKKSSSTTARDAYYKYIFGR
VAESAGQNGLLAGANFWAWGGFAGQAEGHDDWRRGDEYCGDPAQEAQGLNSVYMGDSTIE
VVREGVQAVNAAAPRSWIDVETGSGIFRSGEERKVCCGIVCSNALTEALREGRAQATLEL
SDGLGRERTLEACEISFRDERSATAEFFPTKMEPGFYRASLVVREGGRSSVLCSGNIGFD
PESIVSPQSKMEDFDSFWEATLTELAQVDPQYRFTKLEEYSDEVRDVWRVDMKSFGGADI
SGVLVEPAKEGNYPAFVSYMGYGSSVWYPSKGGSQDRVEFLLCIRNQALNRAEGEKDDWC
TRGLESKETYYYRGAFADAVRAVDMICSRPKTDTSRVYAHGESQGGALTLVAASLDRRIK
GIAPSAPFLNDFEDYFELASWPADPIIAQAESLGISREELMKTLSYFDVKNFTDRIECPV
LMAIGLQDPVCPPHTNFAGYNMIESEKRWICYPHSEHNVWQQKGWPEEKENFFRTLYQ

Enzyme Prediction     

No EC number prediction in MGYG000003525_00021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	379	9.3e-95	0.9930795847750865
CE7	548	823	6.6e-78	0.9169329073482428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05448	AXE1	5.61e-65	552	817	21	299	Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
COG3458	Axe1	1.58e-59	543	817	13	299	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
COG3934	COG3934	1.12e-33	32	440	49	476	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
COG1506	DAP2	2.25e-08	589	794	367	568	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam00326	Peptidase_S9	8.45e-06	676	793	45	160	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SJX74200.1	1.27e-201	305	834	2	525
QQA30547.1	2.72e-170	6	423	6	422
ADD61406.1	2.72e-170	6	423	6	422
ADD62011.1	2.72e-170	6	423	6	422
QUT33697.1	2.72e-170	6	423	6	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	4.81e-90	19	424	16	424	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
4LYP_A	5.39e-65	22	424	32	435	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYQ_A	3.76e-64	22	424	32	435	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E202A mutant [Rhizomucor miehei],4NRR_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRR_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRS_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei],4NRS_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei]
4LYR_A	3.76e-64	22	424	32	435	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]
1L7A_A	8.57e-47	552	836	22	315	structuralGenomics, crystal structure of Cephalosporin C deacetylase [Bacillus subtilis],1L7A_B structural Genomics, crystal structure of Cephalosporin C deacetylase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94388	1.20e-45	552	834	22	313	Cephalosporin-C deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=cah PE=1 SV=1
Q0JKM9	3.30e-42	27	377	37	371	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
Q9FZ29	5.14e-38	6	377	4	361	Mannan endo-1,4-beta-mannosidase 1 OS=Arabidopsis thaliana OX=3702 GN=MAN1 PE=2 SV=1
Q9WXT2	5.82e-37	552	817	22	303	Cephalosporin-C deacetylase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=axeA PE=1 SV=1
Q5W6G0	6.96e-37	102	377	144	416	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003525_00021.